DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ak7a

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001166036.1 Gene:ak7a / 402854 ZFINID:ZDB-GENE-040724-122 Length:696 Species:Danio rerio


Alignment Length:264 Identity:59/264 - (22%)
Similarity:97/264 - (36%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VERYEPEN--IGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEI-------------- 57
            ||.::...  :.|...|||||..||.|.|..|.:.:.:.|::..:.:..:|              
Zfish   345 VEEFKQTRKLLPIKICLLGPPAVGKSTVAEELCKYYKLNHVTVDEAVSEKIRQLEELLERNEKTA 409

  Fly    58 -------SSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKL 114
                   ::..||.|....::..|..:.:..::.:|...|:...|:| ||:|||:|:|..||.:|
Zfish   410 ENEELLSAAEEKLKAIKNSMLQNGGQLDNQQIIHIIMEKLNSMPCRNQGFVLDGYPKTYSQANEL 474

  Fly   115 ---------DTLLDKRKTNLDAVIEFAID----DSLLVRRITGRLIHQASGRSY-HEEF----AP 161
                     |....:.|.|...:.||...    |..|..|:.....:.|..:.| .|||    |.
Zfish   475 FQDENMEVEDGRATEPKYNKVMIPEFVFSLDATDDFLKARVRSLPQNVAEMKHYTQEEFTDSLAK 539

  Fly   162 PKKPMTDD------------------------------VTGEPL-IRRSDDNAEALKKRLE-AYH 194
            .::.:.:|                              ..|.|: ...|.:..|..|||.| ..|
Zfish   540 FRQTLAEDESVLDYFDELEIHPEHIDCENVAVVEKIIKTVGRPMNYGLSPEEMEEEKKRKEHERH 604

  Fly   195 KQTK 198
            :|.|
Zfish   605 QQLK 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 56/251 (22%)
ADK 20..222 CDD:238713 56/251 (22%)
ak7aNP_001166036.1 NADB_Rossmann <162..288 CDD:304358
WcaG <208..288 CDD:223528
ADK 358..568 CDD:238713 45/209 (22%)
Dpy-30 653..694 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.