DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Adk1

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster


Alignment Length:217 Identity:63/217 - (29%)
Similarity:108/217 - (49%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMID 87
            :||.||.|||||...:.||:...|||:||:||.|::|||..|.:|:.||.:|.|||:|.|:.:::
  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101

  Fly    88 SNLDKPE-CKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQAS 151
            ..:.:.: ...|||:||:||...|..:.:.    |....|..:.|...:..:|:||..|....| 
  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIEFEA----RIAPADLALYFECSEDTMVQRIMARAAASA- 161

  Fly   152 GRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAA 216
                                    ::|.|||.:.::.||..:.:.|..:::.|..:.|  .::|.
  Fly   162 ------------------------VKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAE 200

  Fly   217 KKSSDVF----STIDSIFQRKR 234
            :...|:|    ..||.:.::|:
  Fly   201 RDVDDIFLEVVQAIDCVLKKKQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 62/214 (29%)
ADK 20..222 CDD:238713 58/199 (29%)
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 62/210 (30%)
ADK 34..206 CDD:238713 58/199 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.