DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Ak5

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001102421.1 Gene:Ak5 / 365985 RGDID:1590818 Length:562 Species:Rattus norvegicus


Alignment Length:216 Identity:66/216 - (30%)
Similarity:111/216 - (51%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMID 87
            |:|.||||||||...|.||:...|||||::||.|::|.|:....::.:|:.|.||...:|::::.
  Rat   381 LMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESERSKLIRDIMERGDLVPSGVVLELLK 445

  Fly    88 ----SNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIH 148
                ::|...:   |||:||:||.|.|.|:....:.:.:      :...:|.|  ...:|.||:.
  Rat   446 EAMVASLGNTK---GFLIDGYPREVKQGEEFGRRIGEPQ------LVICMDCS--ADTMTNRLLQ 499

  Fly   149 QASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKV 213
            ::...                       :|.:|:|:::.|||||||:.:.|::.||..:....||
  Rat   500 RSQSS-----------------------QRGEDSAKSVAKRLEAYHRASIPVIAYYETKTQLQKV 541

  Fly   214 DAAKKSSDVF----STIDSIF 230
            :|......||    :.|||:|
  Rat   542 NAEGTPDQVFLQLCTAIDSVF 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 66/216 (31%)
ADK 20..222 CDD:238713 60/202 (30%)
Ak5NP_001102421.1 aden_kin_iso1 133..316 CDD:130427
ADK 134..307 CDD:238713
aden_kin_iso1 374..561 CDD:130427 64/213 (30%)
ADK 378..550 CDD:238713 60/202 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.