DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and CG9541

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster


Alignment Length:200 Identity:41/200 - (20%)
Similarity:72/200 - (36%) Gaps:78/200 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCV---------CHLSTGDMLRAEISSGSKLGAE---LKKVMDAGK 75
            ::|.|||.|.|        .|:         .|:|.|.:||....|..:...|   :|:.:.||.
  Fly   362 VIGGPGSNKAT--------LCLKAVGLNPGWAHISVGRLLRNITDSAPRANTESFAVKEALAAGD 418

  Fly    76 LVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDT---------LLDKRKTNLDAVIEF 131
            :..:..:..::::||.:...:.|.::||:||.:.|.:..:.         |||..|..|      
  Fly   419 MAPEKSLNQLLETNLRQLRDRTGIIVDGYPRNLQQVKYFENKYKQRPPIILLDCSKLQL------ 477

  Fly   132 AIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQ 196
                                ||.                       |.||...:.::|||.:.:|
  Fly   478 --------------------GRG-----------------------RIDDTVSSFRRRLELFREQ 499

  Fly   197 TKPLV 201
            |.|::
  Fly   500 TLPML 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 41/199 (21%)
ADK 20..222 CDD:238713 41/199 (21%)
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 41/199 (21%)
ADK 359..521 CDD:238713 41/199 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.