DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Ak4

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_058831.1 Gene:Ak4 / 29223 RGDID:2078 Length:223 Species:Rattus norvegicus


Alignment Length:215 Identity:79/215 - (36%)
Similarity:130/215 - (60%) Gaps:7/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVV 83
            :.|::||||||||||....:.:.|.:.|||:|.:||..:.:.:::|...|:.::.|.||.|.::.
  Rat     6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTNTEVGDVAKQYLEKGLLVPDHVIT 70

  Fly    84 DMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIH 148
            .::.|.|:....:: :||||||||:||||.||.:.|     :|.||...|....|..|::.|.||
  Rat    71 RLMMSELETRSAQH-WLLDGFPRTLVQAEALDRICD-----VDLVISLNIPFETLKDRLSRRWIH 129

  Fly   149 QASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKV 213
            .:|||.|:.:|.||:....||:|||||:::.||..|||..||..|....||:::.|..||:..:.
  Rat   130 PSSGRVYNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAARLRRYKDAAKPVIELYKSRGVLHQF 194

  Fly   214 DAAKKSSDVFSTIDSIFQRK 233
             :..:::.::..:.::|..|
  Rat   195 -SGTETNRIWPYVYTLFSNK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 78/212 (37%)
ADK 20..222 CDD:238713 77/201 (38%)
Ak4NP_058831.1 adk 7..211 CDD:273569 77/210 (37%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 35..64 7/28 (25%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03170 125..162 17/36 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.