Sequence 1: | NP_523836.2 | Gene: | Adk2 / 37834 | FlyBaseID: | FBgn0283494 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_777283.1 | Gene: | AK5 / 26289 | HGNCID: | 365 | Length: | 562 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 67/213 - (31%) |
---|---|---|---|
Similarity: | 109/213 - (51%) | Gaps: | 36/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI- 86
Fly 87 DSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQAS 151
Fly 152 GRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAA 216
Fly 217 KKSSDVF----STIDSIF 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk2 | NP_523836.2 | adk | 20..233 | CDD:234711 | 67/213 (31%) |
ADK | 20..222 | CDD:238713 | 59/199 (30%) | ||
AK5 | NP_777283.1 | aden_kin_iso1 | 133..316 | CDD:130427 | |
Adenylate kinase 1. /evidence=ECO:0000305|PubMed:19647735 | 133..316 | ||||
ADK | 134..307 | CDD:238713 | |||
NMP 1. /evidence=ECO:0000250|UniProtKB:P00568 | 162..193 | ||||
LID 1. /evidence=ECO:0000250|UniProtKB:P00568 | 256..266 | ||||
aden_kin_iso1 | 374..561 | CDD:130427 | 64/210 (30%) | ||
Adenylate kinase 2. /evidence=ECO:0000305|PubMed:19647735 | 377..559 | 62/208 (30%) | |||
ADK | 378..550 | CDD:238713 | 59/199 (30%) | ||
NMP 2. /evidence=ECO:0000269|Ref.9 | 406..435 | 10/28 (36%) | |||
LID 2. /evidence=ECO:0000269|Ref.9 | 499..509 | 3/32 (9%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |