DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AK5

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_777283.1 Gene:AK5 / 26289 HGNCID:365 Length:562 Species:Homo sapiens


Alignment Length:213 Identity:67/213 - (31%)
Similarity:109/213 - (51%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI- 86
            ::|.||||||||...|.||:...|||||::||.|::|.|:....::.:|:.|.||...:|:::: 
Human   381 IIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLK 445

  Fly    87 DSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQAS 151
            ::.:.......|||:||:||.|.|.|:....:.      |..:...:|.|  ...:|.||:.:: 
Human   446 EAMVASLGDTRGFLIDGYPREVKQGEEFGRRIG------DPQLVICMDCS--ADTMTNRLLQRS- 501

  Fly   152 GRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAA 216
             ||        ..|:             ||..:.:.||||||::.:.|::.||..:....|::|.
Human   502 -RS--------SLPV-------------DDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAE 544

  Fly   217 KKSSDVF----STIDSIF 230
            ....|||    :.|||||
Human   545 GTPEDVFLQLCTAIDSIF 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 67/213 (31%)
ADK 20..222 CDD:238713 59/199 (30%)
AK5NP_777283.1 aden_kin_iso1 133..316 CDD:130427
Adenylate kinase 1. /evidence=ECO:0000305|PubMed:19647735 133..316
ADK 134..307 CDD:238713
NMP 1. /evidence=ECO:0000250|UniProtKB:P00568 162..193
LID 1. /evidence=ECO:0000250|UniProtKB:P00568 256..266
aden_kin_iso1 374..561 CDD:130427 64/210 (30%)
Adenylate kinase 2. /evidence=ECO:0000305|PubMed:19647735 377..559 62/208 (30%)
ADK 378..550 CDD:238713 59/199 (30%)
NMP 2. /evidence=ECO:0000269|Ref.9 406..435 10/28 (36%)
LID 2. /evidence=ECO:0000269|Ref.9 499..509 3/32 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.