DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and F38E11.6

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001023197.1 Gene:F38E11.6 / 259587 WormBaseID:WBGene00009543 Length:418 Species:Caenorhabditis elegans


Alignment Length:242 Identity:60/242 - (24%)
Similarity:105/242 - (43%) Gaps:44/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNAAVPVE-------RYEPENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIS-- 58
            |.|.:||:       ..:...|.| ..:.|.|.|.||:....|...|....:|..|::.....  
 Worm    21 PPAPIPVDVGSAIRHHLQKNPIAI-VFIFGGPASQKGSIIEELTSSFNFTSISVEDIVFQYFPSR 84

  Fly    59 -SGSKLGAELKKVMDAGK----LVSDDLVVDMIDSNLDKPECKNGFLLDGFP--RTVVQAEKLDT 116
             |||  |.::|.:.||.:    ::|.|.|::||.|.: |......|::|..|  .::::||:...
 Worm    85 LSGS--GTQIKDIQDALRNDEGMLSIDWVLEMISSRI-KMTMNQRFVVDIVPAVSSILKAEEYRA 146

  Fly   117 LLDKRKTN---LDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRR 178
            ....|:.|   :...|.||||.::...:...:|..:|:|:....:...|:.        ..::|.
 Worm   147 RSHDRQLNQFEMKHPISFAIDVTVKDEQALTKLNGEANGKDEDSKRINPEL--------NQMMRG 203

  Fly   179 SDD-NAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFS 224
            :|| :...|:||:..||...:|.:.|:            :|||.|.|
 Worm   204 ADDIDRGKLEKRIAEYHTCAEPFLQYF------------RKSSRVVS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 54/218 (25%)
ADK 20..222 CDD:238713 52/214 (24%)
F38E11.6NP_001023197.1 aden_kin_iso1 42..250 CDD:130427 56/221 (25%)
NK 44..237 CDD:302627 53/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.