DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ZK673.2

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_496245.1 Gene:ZK673.2 / 174608 WormBaseID:WBGene00014058 Length:222 Species:Caenorhabditis elegans


Alignment Length:214 Identity:66/214 - (30%)
Similarity:118/214 - (55%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLGPPGSGKGTQAPLLKEKF---CVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVV 83
            :|.|..||||||.|.:|..:|   ...:.:.||.:|..|:.|::.|...:..::.|:.|.|.::.
 Worm     5 LLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKGEHVPDSILN 69

  Fly    84 DMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIH 148
            ..|.:.:.|...:  .:|||:||.:.|.:.::     .:..|:.::|..:...:|:.|::.:|:|
 Worm    70 GAILAEMLKAGPR--VVLDGYPRNMSQLKMVE-----EQAPLNLIVELKVPRKVLIDRLSKQLVH 127

  Fly   149 QASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKV 213
            .||||:|:.|..|||:...||:|||||.:||.|..|..::|||.|.|....::|||..:.....:
 Worm   128 PASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYKKQNKCITM 192

  Fly   214 DAAKKSSDVFSTIDSIFQR 232
             :.:.|..||.::..:.:|
 Worm   193 -SGESSKAVFESVAEVMRR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 66/214 (31%)
ADK 20..222 CDD:238713 63/202 (31%)
ZK673.2NP_496245.1 adk 3..209 CDD:273569 65/211 (31%)
ADK 3..197 CDD:238713 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S240
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.