DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AK7

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006720084.1 Gene:AK7 / 122481 HGNCID:20091 Length:730 Species:Homo sapiens


Alignment Length:187 Identity:46/187 - (24%)
Similarity:74/187 - (39%) Gaps:50/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGA------------------ 65
            |...:||||..||.:.|..|...:.:.|:...|::...|   :||.|                  
Human   368 IKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAI---AKLEAIVAPNDVGEGEEEVEEEE 429

  Fly    66 ELKKVMDAGKL--------------VSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKLD 115
            |.:.|.||.:|              :.|..::..:...|....|:| |::|||||:|..||:.|.
Human   430 EEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLF 494

  Fly   116 TLLDKRKTN--------LDAVI--EF--AID--DSLLVRRITGRLIHQASGRSYHEE 158
            ...|:.:.:        .|.:|  ||  |:|  |..|..|:........:|..|.::
Human   495 NQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQD 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 45/186 (24%)
ADK 20..222 CDD:238713 45/186 (24%)
AK7XP_006720084.1 WcaG <147..310 CDD:223528
NADB_Rossmann <149..307 CDD:304358
ADK 369..>548 CDD:238713 44/181 (24%)
Dpy-30 679..>711 CDD:253069
GVQW 713..>730 CDD:290611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.