DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Ak1

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_067490.1 Gene:Ak1 / 11636 MGIID:87977 Length:210 Species:Mus musculus


Alignment Length:215 Identity:80/215 - (37%)
Similarity:117/215 - (54%) Gaps:51/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI- 86
            ::|.||||||||...:.:|:...||||||:||||:||||:.|.:|..:|:.|:||..|.|:||: 
Mouse    29 VVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLR 93

  Fly    87 DSNLDKPECKNGFLLDGFPRTVVQAEKLD------TLLDKRKTNLDAVIEFAIDDSLLVRRITGR 145
            |:.|.|.:..||||:||:||.|.|.|:.:      |||    ..:||..|          .:|.|
Mouse    94 DAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLL----LYVDAGAE----------TMTQR 144

  Fly   146 LIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLH 210
            |:.:.                  :.:|     |.|||.|.:|||||.|:..|:|::.:|..||:.
Mouse   145 LLKRG------------------ETSG-----RVDDNEETIKKRLETYYNATEPVISFYDKRGIV 186

  Fly   211 FKVDAAKKSSDVFSTIDSIF 230
            .||:|.       .|:|::|
Mouse   187 RKVNAE-------GTVDTVF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 80/215 (37%)
ADK 20..222 CDD:238713 77/205 (38%)
Ak1NP_067490.1 aden_kin_iso1 22..209 CDD:130427 80/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.