DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ak4

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_002931643.1 Gene:ak4 / 100495400 XenbaseID:XB-GENE-959954 Length:231 Species:Xenopus tropicalis


Alignment Length:191 Identity:77/191 - (40%)
Similarity:112/191 - (58%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVV 83
            :.|::||||||||||....:.:.|.:.|||:||.||..|.:.:::|...||.::.|..|.|.|:.
 Frog     6 LRAVILGPPGSGKGTVCQRIAKNFGLQHLSSGDFLRQNIRASTEVGVMAKKYLEQGLPVPDSLIT 70

  Fly    84 DMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIH 148
            .::...|:..:.: .:||||||||:.|||.||.:.|     ||.||...|....|..|:..|.||
 Frog    71 RVMLFELETMKTQ-PWLLDGFPRTLAQAEALDKICD-----LDLVISLNIPFETLKDRLNTRWIH 129

  Fly   149 QASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGL 209
            |.|||.|:.||.||.....||::|||||::..|..:|:..||..|....||:::.|..:|:
 Frog   130 QPSGRVYNLEFNPPHVQGIDDISGEPLIQQEHDKPDAVISRLRQYKDVAKPVIELYKNKGI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 77/190 (41%)
ADK 20..222 CDD:238713 77/190 (41%)
ak4XP_002931643.1 adk 7..211 CDD:273569 77/190 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.