DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and GATL6

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001031573.1 Gene:GATL6 / 827438 AraportID:AT4G02130 Length:346 Species:Arabidopsis thaliana


Alignment Length:335 Identity:78/335 - (23%)
Similarity:124/335 - (37%) Gaps:91/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YPDIPATTPSVPPVLRPTHYLLNYSSTQLELSSHLNGLSSDYNIFVIYTRENYHLNLKFDLFAHS 181
            :|...|...|..|:.|....:.|.....  |||  .|:.:...:.|..|.:..:|.... ...:|
plant    27 FPPAAAIRSSPSPIFRKAPAVFNNGDEC--LSS--GGVCNPSLVHVAITLDVEYLRGSI-AAVNS 86

  Fly   182 LLKHT--SAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYTIYDVK-------VCSSIIQDIA 237
            :|:|:  ...:..|.|..|| :.::||.|.|.:  |.| :.:.|||..       :.||:.|.:.
plant    87 ILQHSVCPESVFFHFIAVSE-ETNLLESLVRSV--FPR-LKFNIYDFAPETVRGLISSSVRQALE 147

  Fly   238 AKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQL 302
            ..|     :...||.:|.|           :..:||.|.||.|:|...|:..|:.   ..|..::
plant   148 QPL-----NYARSYLADLL-----------EPCVNRVIYLDSDLVVVDDIAKLWK---TSLGSRI 193

  Fly   303 YGLAPELTPVYRHILY-RY-------RVRYPKTSFG-NPYYPINNEGGNQHSRVHHGYPGLNSGV 358
            .| |||    |.|..: :|       ..|:..|..| .|.|                   .|:||
plant   194 IG-APE----YCHANFTKYFTGGFWSEERFSGTFRGRKPCY-------------------FNTGV 234

  Fly   359 VLLLLNRIRNSKSYLEKLTH-SEVHTLVAKYSFKGHLGDQDFFTLL--GYEYPNLIYRLDCIWNR 420
            :::.|.:.|.. .|.:::.. .|:......|    .||....|.|:  |:..|        |.:|
plant   235 MVIDLKKWRRG-GYTKRIEKWMEIQRRERIY----ELGSLPPFLLVFSGHVAP--------ISHR 286

  Fly   421 QLCTWWKDHG 430
                 |..||
plant   287 -----WNQHG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 62/270 (23%)
GATL6NP_001031573.1 Glyco_transf_8 67..321 CDD:279798 68/291 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.