DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and Gxylt2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_001066466.1 Gene:Gxylt2 / 688618 RGDID:1586482 Length:444 Species:Rattus norvegicus


Alignment Length:438 Identity:94/438 - (21%)
Similarity:151/438 - (34%) Gaps:146/438 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARYPDIP--------AT 123
            |...|||:.:.|.:|.:.:   |..|.::......:|  ..:..:::.|..|.:|        |.
  Rat     6 KAAALLLLALAVLLLALLS---LRARQDLEPPGFPAR--PEAAPQRRHAPVPTLPPEPRAFPGAA 65

  Fly   124 TPSV----PPVLRP----------------THYLLNYSSTQLELSSHLNGLSSDYNIFVIYTREN 168
            .|..    ||.|||                :..:.:..|...||..||..::....:      |.
  Rat    66 GPRFPRRRPPRLRPGASRPRAASRGKLARRSGEVRSLHSVPPELWIHLAVVACGNRL------EE 124

  Fly   169 YHLNLKFD-LFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYTIYDVKVCSSI 232
            ..:.||.. ||:|       .::..|:.|:...:|.    ..:|:|::.             .|.
  Rat   125 TLVMLKSAVLFSH-------RKMRFHIFTEDALKPE----FDKQLRQWP-------------DSY 165

  Fly   233 IQDIAAKLSPYFSSTPNSYYSDSLF--------FLSLGLHRIADRSLNRAILLDCDIVFRSDVRL 289
            .:....||.|...|..|......||        ||.:.|     :.::..:.:|.|::|...|..
  Rat   166 TKKFEHKLYPITFSVGNPQEWKKLFKPCAAQRLFLPVIL-----KDVDSLLYVDTDVLFLRPVDD 225

  Fly   290 LFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSF-----GNPYYPINNEGGNQHSRVHH 349
            ::.....|...||..:|||      |       ..||..:     .:|:|               
  Rat   226 IWKLLRQFNSTQLAAMAPE------H-------EIPKIGWYSRFARHPFY--------------- 262

  Fly   350 GYPGLNSGVVLLLLNRIRNSKSYLEKLTHSEVHT----------LVAKYSFKGHLGDQDFFTLLG 404
            |..|:||||:|:.|.|||::     :..:|.:.|          |..||......||||...::.
  Rat   263 GSAGVNSGVMLMNLTRIRST-----QFKNSLIPTGLAWEEMLLPLYQKYKNAITWGDQDLLNIIF 322

  Fly   405 YEYPNLIYRLDCIWNRQLCTWWKDHGYSQIFDAYFRCEGNIKMYHGNC 452
            |..|..:|...|.||     :..||           |     ||..||
  Rat   323 YFNPECLYVFPCQWN-----YRPDH-----------C-----MYGSNC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 62/273 (23%)
Gxylt2XP_001066466.1 GT8_like_2 111..414 CDD:133052 72/328 (22%)
RfaJ 127..396 CDD:224359 69/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.