DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and Large1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001101909.1 Gene:Large1 / 361368 RGDID:1308895 Length:385 Species:Rattus norvegicus


Alignment Length:422 Identity:100/422 - (23%)
Similarity:160/422 - (37%) Gaps:110/422 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CRWQKK-LVLLLIFICVCVL---IVFANTHLLVRGNILSAFLSSRLNKHSHA-----------EK 112
            ||.::| |...|..:|:..|   .:||.:  |..|..:|.   |.|...:|:           |.
  Rat     5 CRGRRKFLAASLTLLCIPALTWIYLFAGS--LEDGKPVSL---SPLESQAHSPRYTASSQRERES 64

  Fly   113 QEARYPDIPATTPSVPPVL------RPTHYLLNYSST----------QLELSSHLNGLSSD---- 157
            .|.|..::.....::...|      .|.|...|:|.|          :.:.:..:.|.||:    
  Rat    65 LEVRVREVEEENRALRRQLSLAQGQSPAHRRGNHSKTYSMEEGTGDSENQRAGIVAGNSSECGQQ 129

  Fly   158 ------YNIFVIYTRENYHLNLKFDLFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFR 216
                  ..|.|......|:.:........|:|.|....||.|:|.||.::               
  Rat   130 PAVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAE--------------- 179

  Fly   217 RTVIYTIYDVKVCSSIIQDI--AAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDC 279
             .::.|::...:..::..|.  |.:|....|..||.:||.....:.|.|.:....:|.|.|:||.
  Rat   180 -QILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIVLDT 243

  Fly   280 DIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGNPYYPINNEGGNQH 344
            ||.|.:|:..|:..|..|...|:.||....:..|               .||.:           
  Rat   244 DITFATDIAELWAVFHKFKGQQVLGLVENQSDWY---------------LGNLW----------- 282

  Fly   345 SRVHHGYP----GLNSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYSFKG----HLGDQDFFT 401
             :.|..:|    |.|:||:||||:::|       |:...::..|.|:....|    .|.|||.|.
  Rat   283 -KNHRPWPALGRGYNTGVILLLLDKLR-------KMKWEQMWRLTAERELMGMLSTSLADQDIFN 339

  Fly   402 LLGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQ 433
            .:..:.|.|:|:|.|.||.||    .||..|:
  Rat   340 AVIKQNPFLVYQLPCFWNVQL----SDHTRSE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 65/259 (25%)
Large1NP_001101909.1 RfaJ 136..>359 CDD:224359 68/272 (25%)
GT8_LARGE_C 138..377 CDD:133053 73/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8078
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.