DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and bgnt-1.5

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001024774.1 Gene:bgnt-1.5 / 3565692 WormBaseID:WBGene00010694 Length:403 Species:Caenorhabditis elegans


Alignment Length:351 Identity:64/351 - (18%)
Similarity:105/351 - (29%) Gaps:141/351 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 NIFVI------YTRENYHLNLKFDLFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFRR 217
            :||.|      ::..||:|...||       ||....|....| |:|.|                
 Worm    15 SIFAICLYIFGFSERNYNLKTIFD-------KHGKISLENGFI-DTEMQ---------------- 55

  Fly   218 TVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIA-------------DR 269
                   :.:.|          :...|....|.:..|.|..::|.:|..:             |.
 Worm    56 -------NDEYC----------VGYNFLEATNMFREDGLEPVTLAVHGTSEMMKAIEKKPLNWDG 103

  Fly   270 SLNRAILLD---------------CDIVFRSDVRLLFNEFDNFLPHQLYGLAPE--LTPVYR--- 314
            .::..:.:|               ||..||..|.:.|    .|......|..|:  ::|..|   
 Worm   104 PISFGLFIDFHSRQVLEYISEVHRCDEKFREKVTVHF----AFRLSAFQGSCPQIKISPTNRECK 164

  Fly   315 ---HILYRYRVRYPKTSFGNPY--YPIN------NEGGNQHSRVHHGYPG---LNSGVV------ 359
               |...:||     .:.|.|:  ||.|      .:|..  |.:|....|   ::.|..      
 Worm   165 EFLHNRDKYR-----QAAGGPFQLYPSNLMRNIARQGAK--SDIHFIADGDMVMSEGFAMKIKPI 222

  Fly   360 -----------LLLLNRI--------RNSKSYLEKLTHSEVHTLVAKYSFKGH-----------L 394
                       ||::.|.        |:.|...|.:.:.:|.....|:.|.||           .
 Worm   223 ANQVIDGTSKNLLVVRRFETNETTIPRDHKQLQESIKNKKVFQFHHKFFFSGHKIANISHWFAVS 287

  Fly   395 GDQDFFTLLGYEYPNLIYRLDCIWNR 420
            .:.|..|.....|.:.::.:..|.:|
 Worm   288 NNTDRITTWEIPYSSSLWEVQVILHR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 58/332 (17%)
bgnt-1.5NP_001024774.1 Glyco_transf_49 79..391 CDD:290607 44/246 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.