DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and bgnt-1.1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001023113.1 Gene:bgnt-1.1 / 3564773 WormBaseID:WBGene00008491 Length:412 Species:Caenorhabditis elegans


Alignment Length:137 Identity:33/137 - (24%)
Similarity:49/137 - (35%) Gaps:43/137 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HKTFPA----------------DLNMYGMKC--KSQLLEDQENVTLIINRRNSIRQKPKSWAWTL 60
            ||.|||                ....|..|.  ||...|.|    ||::|::     |.:..:..
 Worm   278 HKYFPAGHTIESLWQWFRMSKNQTEAYAWKIDYKSSSWEAQ----LILHRKD-----PYNPEYIP 333

  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHL--LVRG------NILSAFLSSRLNKHSHAEKQ---- 113
            .|.|.|:.||..|   |.........:|:  :.||      |:.||.|:.:....:.:.|:    
 Worm   334 TRIRDQQSLVYEL---CRANYTFHLASHVFNVHRGVKTKETNLSSAVLTHQKRLRTRSYKRFMHY 395

  Fly   114 -EARYPD 119
             ...|||
 Worm   396 INTTYPD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700
bgnt-1.1NP_001023113.1 Glyco_transf_49 85..400 CDD:290607 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.