DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and CG11149

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster


Alignment Length:329 Identity:56/329 - (17%)
Similarity:99/329 - (30%) Gaps:130/329 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 FVIYTRENYHLNLKFDL--FAHSLLKHTSA---QLHLHVITDSESQPSVLEILQRQIRRFRRTVI 220
            |.|:| ..|.||...|.  :..:.|..:.:   .:..||...::..|..:...:.::      ::
  Fly   158 FAIHT-PGYDLNTTLDAIRYVRNCLPESDSIKDWVSFHVYFPNQHMPEYVPYDEAEV------LM 215

  Fly   221 YTIYDVKVCSSIIQDIAAKLSPYFSSTP--NSYYSDSLFFLSLGLHR-IADRSLNRAILLDCDIV 282
            |.........|::       ||.::..|  :||.|.:.....:.:.| ||..:.|...:..|||.
  Fly   216 YPHMCTLANGSLV-------SPLYTQIPTTDSYKSRANLTYPINVGRNIARLATNTHFIFACDIE 273

  Fly   283 FRSDVRLLFNEFDNFLP-----HQLYGLAP-------------------------ELTPVYR--- 314
            ....|..:    |.||.     |.:..|.|                         ||..:||   
  Fly   274 LYPSVGFV----DQFLDMVARNHSVLALDPRQRRRVYPLPVFEIETGAKVPVDKDELLALYRKQQ 334

  Fly   315 ------------------------------HI-LYRYRVRYPKTSFGNPYY------PINNE--- 339
                                          |: ::...:|..|.....|:|      |:.:|   
  Fly   335 AQVFHLKLCPTCHTIPGQEEWLNRTSRADDHLHVFSKALRKWKFRAWEPFYVSDNTEPLFDERVT 399

  Fly   340 -GGNQHSRVHHGYPGLNSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYSFKGHLGDQDFFTLL 403
             .|..:.|:...|                    |..:::.|:.:.|:..|:          ..||
  Fly   400 WEGQSNKRIQVSY--------------------YCSQVSVSQCNLLLQNYA----------MCLL 434

  Fly   404 GYEY 407
            .|||
  Fly   435 DYEY 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 51/318 (16%)
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 56/329 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447389
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.