DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and Large2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_006234624.1 Gene:Large2 / 311202 RGDID:735214 Length:715 Species:Rattus norvegicus


Alignment Length:333 Identity:94/333 - (28%)
Similarity:142/333 - (42%) Gaps:91/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NYSSTQLEL-------SSHLNGLSSDYNIFVIYTRENYHLNLKFDLFAHSLLKHTSAQLHLHVIT 196
            |.|::.|:|       ..|:..:.:.||    .:||...|       ..|:|.:....||||:||
  Rat    75 NRSTSSLQLLLPPKCEMLHVAIVCAGYN----SSREIITL-------MKSVLFYRKNPLHLHLIT 128

  Fly   197 DSESQPSVLEILQRQIRRFRR----TVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPNSYYSDSLF 257
            |:.:: ::||.|      ||.    .|:.:.||           |.:|.|..|..||.:||....
  Rat   129 DAVAR-NILETL------FRTWMVPAVVVSFYD-----------AEELKPLVSWIPNKHYSGLYG 175

  Fly   258 FLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRV 322
            .:.|.|..:...||.|.|:||.|:.|.||:..|:..|.:|...|:.||....:..|         
  Rat   176 LMKLVLPSVLPLSLARVIVLDTDVTFSSDIMELWALFGHFSDKQVVGLVENQSDWY--------- 231

  Fly   323 RYPKTSFGNPYYPINNEGGNQHSRVHHGYP----GLNSGVVLLLLNRIRN-SKSYLEKLT-HSEV 381
                  .||.:            :.|..:|    |.|:||:||.|:|::. ....:.||| ..|:
  Rat   232 ------LGNLW------------KNHRPWPALGRGFNTGVILLWLDRLQQIGWEQMWKLTAKREL 278

  Fly   382 HTLVAKYSFKGHLGDQDFFTLLGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQIFDAYFRC---EG 443
            .||.|.     .|.|||.|..:..|:|.|::.|.|:||.||    .||..::      ||   ..
  Rat   279 LTLTAT-----SLADQDIFNAVIKEHPELVHPLPCVWNVQL----SDHTLAE------RCYLEAA 328

  Fly   444 NIKMYHGN 451
            ::|:.|.|
  Rat   329 DLKVIHWN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 75/259 (29%)
Large2XP_006234624.1 GT8_LARGE_C 92..371 CDD:133053 90/316 (28%)
RfaJ 93..>340 CDD:224359 90/315 (29%)
Glyco_transf_49 426..660 CDD:290607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8078
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.