DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and B4gat1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001099794.1 Gene:B4gat1 / 293667 RGDID:1309541 Length:415 Species:Rattus norvegicus


Alignment Length:358 Identity:65/358 - (18%)
Similarity:120/358 - (33%) Gaps:127/358 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARY----PDIP 121
            :||.:.:.|:..|:.:.:..|:..         ::||..         |.::::.:|    |..|
  Rat     7 IRCAFYQLLLAALMLVAMLQLLYL---------SLLSGL---------HGQEEQEQYFEFFPPSP 53

  Fly   122 ATTPSVPPVLR---------------------------PTHYLLNYSSTQLELSS--HLNGLSSD 157
            .:...|...||                           |...:|   :|...:.:  ||:||...
  Rat    54 RSVDQVKSQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVIL---ATHASVDNLLHLSGLLER 115

  Fly   158 Y------NIFVIYTRENYHLNLKFDLFAHSLLKH---TSAQLHLHVITDSESQPSVLEILQRQIR 213
            :      ::|.. |||...|   ..:.|::|..|   ..|::.:|::..|..:.:|.:  .|:..
  Rat   116 WEGPLSVSVFAA-TREEAQL---ATVLAYALSSHCPEMRARVAMHLVCPSRYEAAVPD--PREPG 174

  Fly   214 RFRRTVIYTIYDVKVCSSIIQDIAAKLSP---YFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAI 275
            .|..        ::.|..:...:|....|   |...| |..|.::|      |..:|....|.|:
  Rat   175 EFAL--------LRSCQEVFDKLARVAQPGINYALGT-NISYPNNL------LRNLAREEANYAL 224

  Fly   276 LLDCDIV------------------------------FRSDVRLLFNEFDNFLPHQL-------Y 303
            ::|.|:|                              .|...|:..|:.:....:|:       |
  Rat   225 VIDVDMVPSEGLWRSLREMLDQSNHWDGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYY 289

  Fly   304 GLAPELTPVYRHILYRYRVRYPKTSFGNPYYPI 336
            ||.   ||.:....|...|..|:.|...|.|.:
  Rat   290 GLC---TPCHAPTNYSRWVNLPEESLLRPAYVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 39/208 (19%)
B4gat1NP_001099794.1 Glyco_transf_49 94..408 CDD:404735 50/253 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.