DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and GXYLT1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_775872.1 Gene:GXYLT1 / 283464 HGNCID:27482 Length:440 Species:Homo sapiens


Alignment Length:316 Identity:70/316 - (22%)
Similarity:114/316 - (36%) Gaps:95/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQI---------------------------RRF 215
            |.:||......::||.|:...|.....:.:|:..|                           ..|
Human   104 FRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIFSIKPLQFHIFAEDQLHHSFKGRLDNWSF 168

  Fly   216 RRTVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCD 280
            .:|..||:|.:...|    :.||:....|...     :....||.|.|     :.::..:.:|.|
Human   169 LQTFNYTLYPITFPS----ENAAEWKKLFKPC-----ASQRLFLPLIL-----KEVDSLLYVDTD 219

  Fly   281 IVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGN-----PYYPINNEG 340
            |:|...|..:::....|...|:..:|||      |       ..|:..:.|     |||      
Human   220 ILFLRPVDDIWSLLKKFNSTQIAAMAPE------H-------EEPRIGWYNRFARHPYY------ 265

  Fly   341 GNQHSRVHHGYPGLNSGVVLLLLNRIRNSKSYLEKLTHSEVH------TLVAKYSFKGHLGDQDF 399
                     |..|:||||:|:.:.|:|. |.:...:|...:.      .|:.||......||||.
Human   266 ---------GKTGVNSGVMLMNMTRMRR-KYFKNDMTTVRLQWGDILMPLLKKYKLNITWGDQDL 320

  Fly   400 FTLLGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQIFDAYFRC----EGNIKMYHGN 451
            ..::.:..|..::...|.||     :..||   .|:.:  .|    ||.|.:.|||
Human   321 LNIVFFHNPESLFVFPCQWN-----YRPDH---CIYGS--NCQEAEEGGIFILHGN 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 60/281 (21%)
GXYLT1NP_775872.1 GT8_like_2 116..417 CDD:133052 67/304 (22%)
RfaJ <184..>345 CDD:224359 45/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.