DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and Large2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_006499317.1 Gene:Large2 / 228366 MGIID:2443769 Length:715 Species:Mus musculus


Alignment Length:410 Identity:107/410 - (26%)
Similarity:166/410 - (40%) Gaps:114/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VLLLIFICVCVLIVFANT-------------HLLVRGNILSAFLSSRLNKHSHAEKQEARYPDIP 121
            ||||:.:.|....:|...             .|..|..:.....|..|...:..::...|..::.
Mouse    14 VLLLLLLLVVGFFLFGRDPDCKRRSWAGEEGTLCDRCLLTPRVFSDGLGTTATLDEDPYRSRNLS 78

  Fly   122 ATTPS--VPPVLRPTHYLLNYSSTQLELSSHLNGLSSDYNIFVIYTRENYHLNLKFDLFAHSLLK 184
            |::|.  :||.....|..:               :.:.||    .:||...|       ..|||.
Mouse    79 ASSPQLLLPPKCEMLHVAI---------------VCAGYN----SSREIITL-------TKSLLF 117

  Fly   185 HTSAQLHLHVITDSESQPSVLEILQRQIRRFRR----TVIYTIYDVKVCSSIIQDIAAKLSPYFS 245
            :....||||:|||:.:: ::||.|      ||.    .|:.:.||           |.:|.|..|
Mouse   118 YRKNPLHLHLITDAVAR-NILETL------FRTWMVPAVVVSFYD-----------AEELKPLVS 164

  Fly   246 STPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELT 310
            ..||.:||.....:.|.|..|...||.|.|:||.|:.|.||:..|:..||:|...|:.||....:
Mouse   165 WIPNKHYSGLYGLMKLVLPSILPPSLARVIVLDTDVTFSSDIVELWALFDHFSDKQVVGLVENQS 229

  Fly   311 PVYRHILYRYRVRYPKTSFGNPYYPINNEGGNQHSRVHHGYP----GLNSGVVLLLLNRIRNSK- 370
            ..|               .||.:            :.|..:|    |.|:||:||.|:|::.:. 
Mouse   230 DWY---------------LGNLW------------KNHRPWPALGRGFNTGVILLWLDRLQQTGW 267

  Fly   371 SYLEKLT-HSEVHTLVAKYSFKGHLGDQDFFTLLGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQI 434
            ..:.|:| ..|:.||:|.     .|.|||.|..:..|:|:|::.|.|:||.||    .||..:: 
Mouse   268 EQMWKVTAKRELLTLMAT-----SLADQDIFNAVIKEHPHLVHPLPCVWNVQL----SDHTRAE- 322

  Fly   435 FDAYFRC---EGNIKMYHGN 451
                 ||   ..::|:.|.|
Mouse   323 -----RCYLEAADLKVIHWN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 77/259 (30%)
Large2XP_006499317.1 GT8_LARGE_C 93..372 CDD:133053 92/331 (28%)
Glyco_transf_49 427..660 CDD:372794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.