DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and Gxylt1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001333714.1 Gene:Gxylt1 / 223827 MGIID:2684933 Length:435 Species:Mus musculus


Alignment Length:282 Identity:64/282 - (22%)
Similarity:106/282 - (37%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LHLHVITDSESQPSVLEILQRQ--IRRFRRTVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPNSYY 252
            ||:|:..:.:...|..:.|...  :|||.    |::|.:    :...|.||.....|...     
Mouse   140 LHVHIFAEDQLHDSFKDRLASWSFLRRFD----YSLYPI----TFPGDSAADWKKLFKPC----- 191

  Fly   253 SDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHIL 317
            :....||.|.|     :.::..:.:|.||:|...|..:::....|...|:..:|||      |  
Mouse   192 ASQRLFLPLIL-----KEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPE------H-- 243

  Fly   318 YRYRVRYPKTSFGN-----PYYPINNEGGNQHSRVHHGYPGLNSGVVLLLLNRIRNSKSYLEKLT 377
                 ..|:..:.|     |||               |..|:||||:|:.:.|:|. |.:...:|
Mouse   244 -----EEPRIGWYNRFARHPYY---------------GRTGVNSGVMLMNMTRMRR-KYFKNDMT 287

  Fly   378 HSEVH------TLVAKYSFKGHLGDQDFFTLLGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQIF- 435
            .:.:.      .|:.||......||||...::....|..::...|.||     :..||   .|: 
Mouse   288 TARLQWGDILMPLLKKYKLNITWGDQDLLNIVFSHNPESLFVFPCQWN-----YRPDH---CIYG 344

  Fly   436 --------DAYFRCEGNIKMYH 449
                    :..|...||..:||
Mouse   345 SNCREAEEEGVFILHGNRGVYH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 56/244 (23%)
Gxylt1NP_001333714.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.