DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and bgnt-1.7

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001364608.1 Gene:bgnt-1.7 / 188531 WormBaseID:WBGene00011779 Length:399 Species:Caenorhabditis elegans


Alignment Length:346 Identity:62/346 - (17%)
Similarity:115/346 - (33%) Gaps:128/346 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 THYLLNYSSTQLELSSHLNGLSSDYNIFVIYTRENYHLNLKFDLF--AHSLLKHTSA-------- 188
            |.:|.|...:||.:.| |:|        ::|.:.|....:..:.|  .:..|:.|..        
 Worm    21 TWHLYNSKDSQLTIKS-LDG--------ILYIQRNVSTEMHDEQFCVCYQFLEATETFREDGLEP 76

  Fly   189 -QLHLH----VITDSESQP---------------------SVLEILQRQIRRFRRTVIYTIYDVK 227
             .|.:|    |:.:.|::|                     :.:.:|.:....|||..  |::   
 Worm    77 ITLAVHGSPEVLGEIENKPFNWDGPISFGLFIDFHSQHALNYISMLHKCHADFRRKT--TVH--- 136

  Fly   228 VCSSIIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFN 292
                    .|.::||..:..|..|.|.                     ..||...|:.:..|| .
 Worm   137 --------FAFRISPSQTECPVIYTSG---------------------YKDCVTFFQKNTELL-E 171

  Fly   293 EFDNFLPHQLY-----------GLAPELTPVYRHILYRYRVRYPKTSFGNPYYPINNEGGNQHSR 346
            |.::  |.|:|           |...:|     |::....: ...|:|.....|:.|        
 Worm   172 EMED--PFQIYPINLMRNIARRGAKSDL-----HLIVDTDM-VMSTNFAKMVKPVAN-------- 220

  Fly   347 VHHGYPGLNSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYSFKGHLGDQDFFTLLGYEYPNLI 411
              ....|:|..|  |::.|...:::.|..........|:.:.:|:.|   ..|| .:|::.||| 
 Worm   221 --RMIDGMNKQV--LVVRRFETNETELPLNLDELEQGLLNENTFEFH---HSFF-FVGHQIPNL- 276

  Fly   412 YRLDCIWNRQLCTWWKDHGYS 432
                        :.|.::.|:
 Worm   277 ------------SEWFENSYA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 50/296 (17%)
bgnt-1.7NP_001364608.1 Glyco_transf_49 76..387 CDD:404735 49/282 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.