DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and lge-1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_509833.3 Gene:lge-1 / 187206 WormBaseID:WBGene00010716 Length:631 Species:Caenorhabditis elegans


Alignment Length:311 Identity:68/311 - (21%)
Similarity:123/311 - (39%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NYSSTQLELSSHLNGLSSDYNI--FVIYTR-----------------ENYHLNLKFDLFAHSLLK 184
            |||.:.. |.....|.||.:.|  ||.:||                 .|:...|.|.....|:||
 Worm     4 NYSISYF-LLILFTGTSSYFTIWNFVDHTRVGAFPEEDYIRLAYIIGGNFMTRLMFMQHFKSVLK 67

  Fly   185 HTSAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPN 249
            ::.....||:|||...:..:.|::             |.:::..|.....:: .:.....:..||
 Worm    68 YSDHFFRLHLITDENHRSDIHELM-------------TSWNISNCEWFFHNL-TEFEKRVAWIPN 118

  Fly   250 SYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYR 314
            |:||.......|.:..|....:.:.:.:|.||:|::::..|:.:|.||...|::|:...|:..| 
 Worm   119 SHYSKYYGLSKLLIPEIIGNDIGKIMFMDVDIIFQTNIFDLWKQFRNFNNSQVFGMVENLSDWY- 182

  Fly   315 HILYRYRVRYPKTSFGNPYYPINNEGGNQHSRVHHGYP----GLNSGVVLLLLNRIRN----SKS 371
                                 :|.:|...      .:|    |.|:|:::..|:::|.    ||.
 Worm   183 ---------------------LNKDGKKS------VWPALGRGFNTGIIMFDLDKLRKNGWASKW 220

  Fly   372 YLEKLTHSEVHTLVAKYSFKGHLGDQDFFTLLGYEYPNLIYRLDCIWNRQL 422
            .:....:..:|...|       :.|||.|....::||..|.::.|.:|.||
 Worm   221 RVVANKYLRIHGKTA-------MSDQDIFNAYIHDYPTEIIQIPCAYNYQL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 53/257 (21%)
lge-1NP_509833.3 GT8_LARGE_C 42..317 CDD:133053 56/272 (21%)
RfaJ 62..>288 CDD:224359 53/252 (21%)
Glyco_transf_49 354..603 CDD:290607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.