DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and bgnt-1.2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001300086.1 Gene:bgnt-1.2 / 184865 WormBaseID:WBGene00017723 Length:406 Species:Caenorhabditis elegans


Alignment Length:444 Identity:82/444 - (18%)
Similarity:148/444 - (33%) Gaps:143/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SAFLSSRLNKHSHAEKQEARY----PDIPATTP---SVPPVLRPTHYLLNYSSTQ---------- 144
            :.|:.:.|....|.:|....|    ||||..|.   |:...:....|.:.|:..:          
 Worm    14 TCFIFTFLIFSEHNQKLSKDYWVEQPDIPEETRKNYSIQTEMYEDQYCVGYNFLEGTGDFREDGL 78

  Fly   145 --LELSSHLNGLSSDYNIFVIYTRENYHLNLKFDLFAHSLLKHTS---AQLHLHVITDSESQPSV 204
              :.|:||   .:||..:                    :|.|.||   ..:.:.:..|..|..::
 Worm    79 EPITLASH---ATSDMML--------------------TLEKMTSMWDGPISVGIFIDFHSSQAL 120

  Fly   205 --LEILQRQIRRFRRTVIYTIYDVKVCSSIIQDIAAKLS-PYFSSTPNSYYSDSLFFLS--LGLH 264
              |..:.|....||:.:  ||: ..:..|..|....|:. |....|...:.:|..:..|  .|..
 Worm   121 EYLAEVHRCDEEFRKKM--TIH-FAIRQSAFQQTCPKIQIPASDRTCWKFRADQSYLRSHLSGPF 182

  Fly   265 RIADRSLNRAI-----------LLDCDIV----FRSDVRLLFNEFDNFLPHQLYGLAPELTPVYR 314
            ::...:|.|.:           ::|.|::    |...::.:.||       .:.|.:.::..:.|
 Worm   183 QLYPSNLMRNLARQGAKSDIHFIMDADMIVSEGFARKLKKVANE-------MIDGKSKKVLAIRR 240

  Fly   315 ------------HILYRYRVRYPKT-SFGNPYYPINNEGGNQHSRVHH----------------- 349
                        |...:..:.|.|| .|.:.::|       |...:.|                 
 Worm   241 FESVNGTYLPRTHFELKQSMAYSKTFEFHHRFFP-------QGHHIEHLEQWFEVSKQSTSVSTM 298

  Fly   350 --GYPGLNSGVVLLLLNRIRNSKSYLE---KLTHSEVHTLV-AKYSFKGHLGDQDFFTLLGYEYP 408
              .:.|....|.::|......:.:|..   |:.||.::.|. |.|:|  |:....|....|.::.
 Worm   299 EIPFAGYEWEVQVILHRNDPYNAAYFPSRIKVMHSLIYALCRAGYTF--HVPSHVFDVHEGIKHT 361

  Fly   409 NLIYRLDCI--------------WNRQLCTWWKDHGYSQIFDAYFRCEGNIKMY 448
            |.||....|              :.|::     |..|....|   :| |..|||
 Worm   362 NTIYSKATIAHQEAYAMDIAGARYVREM-----DEKYPDTLD---KC-GRFKMY 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 56/322 (17%)
bgnt-1.2NP_001300086.1 Glyco_transf_49 80..393 CDD:290607 62/359 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.