DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and LARGE2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_011518188.1 Gene:LARGE2 / 120071 HGNCID:16522 Length:736 Species:Homo sapiens


Alignment Length:282 Identity:76/282 - (26%)
Similarity:119/282 - (42%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 SLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYTIYDVKVCSSIIQDI--AAKLSPY 243
            |:|.:....||||::||:.:                |.::.|::...:..::....  |.:|.|.
Human   118 SMLFYRKNPLHLHLVTDAVA----------------RNILETLFHTWMVPAVRVSFYHADQLKPQ 166

  Fly   244 FSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPE 308
            .|..||.:||.....:.|.|.......|.|.|:||.|:.|.||:..|:..|.:|...|..||...
Human   167 VSWIPNKHYSGLYGLMKLVLPSALPAELARVIVLDTDVTFASDISELWALFAHFSDTQAIGLVEN 231

  Fly   309 LTPVYRHILYRYRVRYPKTSFGNPYYPINNEGGNQHSRVHHGYP----GLNSGVVLLLLNRIRNS 369
            .:..|               .||.:            :.|..:|    |.|:||:||.|:|:|.:
Human   232 QSDWY---------------LGNLW------------KNHRPWPALGRGFNTGVILLRLDRLRQA 269

  Fly   370 K-SYLEKLT-HSEVHTLVAKYSFKGHLGDQDFFTLLGYEYPNLIYRLDCIWNRQLCTWWKDHGYS 432
            . ..:.:|| ..|:.:|.|.     .|.|||.|..:..|:|.|:.||.|:||.||    .||..:
Human   270 GWEQMWRLTARRELLSLPAT-----SLADQDIFNAVIKEHPGLVQRLPCVWNVQL----SDHTLA 325

  Fly   433 QIFDAYFRC---EGNIKMYHGN 451
            :      ||   ..::|:.|.|
Human   326 E------RCYSEASDLKVIHWN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 67/248 (27%)
LARGE2XP_011518188.1 GT8_LARGE_C 97..376 CDD:133053 76/282 (27%)
RfaJ 98..>345 CDD:224359 76/282 (27%)
Glyco_transf_49 431..679 CDD:290607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8703
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.