DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and B4GAT1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_006867.1 Gene:B4GAT1 / 11041 HGNCID:15685 Length:415 Species:Homo sapiens


Alignment Length:461 Identity:83/461 - (18%)
Similarity:151/461 - (32%) Gaps:177/461 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARY----PDIP 121
            :||.:.:.|:..|:.:.:..|:..         ::||..         |.::::.:|    |..|
Human     7 IRCAFYQLLLAALMLVAMLQLLYL---------SLLSGL---------HGQEEQDQYFEFFPPSP 53

  Fly   122 ATTPSVPPVLR---------------------------PTHYLLNYSSTQLELSS--HLNGLSSD 157
            .:...|...||                           |...:|   :|...:.:  ||:||...
Human    54 RSVDQVKAQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVIL---ATHASVDNLLHLSGLLER 115

  Fly   158 Y------NIFVIYTRENYHLNLKFDLFAHSLLKH---TSAQLHLHVITDSESQPSVLEILQRQIR 213
            :      ::|.. |:|...|   ..:.|::|..|   ..|::.:|::..|..:.:|.:  .|:..
Human   116 WEGPLSVSVFAA-TKEEAQL---ATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPD--PREPG 174

  Fly   214 RFRRTVIYTIYDVKVCSSIIQDIAAKLSP---YFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAI 275
            .|..        ::.|..:...:|....|   |...| |..|.::|      |..:|....|.|:
Human   175 EFAL--------LRSCQEVFDKLARVAQPGINYALGT-NVSYPNNL------LRNLAREGANYAL 224

  Fly   276 LLDCDIV------------------------------FRSDVRLLFNEFDNFLPHQL-------Y 303
            ::|.|:|                              .|...|:..|:.:....:|:       |
Human   225 VIDVDMVPSEGLWRGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYY 289

  Fly   304 GLAPELTPVYRHILYRYRVRYPKTSFGNPYY---------PINNEGG-----NQHSRVHHGYPGL 354
            ||.   ||......|...|..|:.|...|.|         |....||     ::..| .:|:   
Human   290 GLC---TPCQAPTNYSRWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFR-QYGF--- 347

  Fly   355 NSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYSF----KGHLGDQDFFTLLGY--------EY 407
                     |||..:         .|:|  ||.:.|    :|.|..:.|...|.:        ::
Human   348 ---------NRISQA---------CELH--VAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQH 392

  Fly   408 PNLIYR 413
            ..::||
Human   393 NKILYR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 58/311 (19%)
B4GAT1NP_006867.1 Glyco_transf_49 94..408 CDD:404735 68/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.