DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and large1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_031754415.1 Gene:large1 / 100498555 XenbaseID:XB-GENE-6250446 Length:754 Species:Xenopus tropicalis


Alignment Length:439 Identity:99/439 - (22%)
Similarity:164/439 - (37%) Gaps:113/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CRWQKKLVL--LLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARYPDIPATTP 125
            ||.::|.:|  |.:.....:..::..|.....|..:|.   |.|:...|:.:..|     |:...
 Frog     5 CRGRRKFLLASLTLLFVPAITWIYLFTGNFDNGKTVSL---SPLDAQPHSPRYLA-----PSQRE 61

  Fly   126 SVPPVLRPTHYLLNYSSTQLELS-----SHLNG-LSSDYN------------------------- 159
            |:...:|...........||.|:     ||.:| .|..|:                         
 Frog    62 SLEVRVREVEEENRLLRKQLSLAQGRGPSHRHGNRSKTYSMEEGTGDSESLRAGIVAGNSSECGQ 126

  Fly   160 ---------IFVIYTRENYHLNLKFDLFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRF 215
                     |.|......|:.:........|:|.|....||.|:|.|:                .
 Frog   127 LPAVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADT----------------I 175

  Fly   216 RRTVIYTIYDVKVCSSIIQDI--AAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLD 278
            .:.::.|::...:..::..|.  |.:|....|..||.:||.....:.|.|.:....||.|.|:||
 Frog   176 AKQILATLFQTWMVPAVRVDFYDADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPASLERVIVLD 240

  Fly   279 CDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGNPYYPINNEGGNQ 343
            .||.|.:|:..|:..|..|...|:.||....:..|               .||.:          
 Frog   241 TDITFATDIAELWAVFHKFKGQQVLGLVENQSDWY---------------LGNLW---------- 280

  Fly   344 HSRVHHGYP----GLNSGVVLLLLNRIRNSK-SYLEKLT-HSEVHTLVAKYSFKGHLGDQDFFTL 402
              :.|..:|    |.|:||:||||:::|..| ..:.:|| ..|:.::::.     .|.|||.|..
 Frog   281 --KNHRPWPALGRGYNTGVILLLLDKLRKMKWEQMWRLTAERELMSMLST-----SLADQDIFNA 338

  Fly   403 LGYEYPNLIYRLDCIWNRQLCTWWKDHGYSQIFDAYFRCEGNIKMYHGN 451
            :..:.|.|:::|.|.||.||    .||..|   :..:|...::|:.|.|
 Frog   339 VIKQNPFLVHQLPCFWNVQL----SDHTRS---EQCYRDVSDLKVIHWN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 64/257 (25%)
large1XP_031754415.1 GT8_LARGE_C 136..415 CDD:133053 76/300 (25%)
Glyco_transf_49 471..740 CDD:404735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8825
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.