DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and gxylt2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002938793.1 Gene:gxylt2 / 100486141 XenbaseID:XB-GENE-5889629 Length:422 Species:Xenopus tropicalis


Alignment Length:438 Identity:92/438 - (21%)
Similarity:153/438 - (34%) Gaps:155/438 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARYP------- 118
            :|.||:    ||...:|:..|::..:.||   ||       ::|.....:.....|.|       
 Frog     1 MRFRWK----LLGSVLCLTGLLLLLHRHL---GN-------AQLQPPPGSTSGRGRTPIATPGYF 51

  Fly   119 ---DIPATTPSVPPVLRPTHYLLNYSSTQL------ELSSHLNGLSSDYNIFVIYTRENYHLNLK 174
               :.|.:...||...:..|.....:..|.      |...||..::....:     .|...:...
 Frog    52 RAAEDPMSRRDVPGGKKKPHLAKVRAPEQKPKPPMPEEWMHLAVVACGDRV-----EETVTMLKS 111

  Fly   175 FDLFAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQIRRFRRTVIYTIYDV------------- 226
            ..||:...:|       .|:..:...:|.....|::..::..|.|.|.||.:             
 Frog   112 AVLFSFKKIK-------FHIFAEDSLKPDFEIKLEKWPQQISRKVEYKIYPITFPVGNPQEWKKL 169

  Fly   227 -KVCSS-------IIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAILLDCDIVF 283
             |.|::       ::||:                 |||.:                  :|.|::|
 Frog   170 FKPCAAQRLFLPMLLQDV-----------------DSLLY------------------VDTDVLF 199

  Fly   284 RSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYR--YRVRYPKTSFGNPYYPINNEGGNQHSR 346
            ...:..::.....|...||..:|||      |.:.:  :..|:.:    :|:|            
 Frog   200 LRPLDHIWAFLRRFNDTQLAAMAPE------HEISKIGWYSRFAR----HPFY------------ 242

  Fly   347 VHHGYPGLNSGVVLLLLNRIRNS--KSYL--EKLTHSE-VHTLVAKYSFKGHL--GDQDFFTLLG 404
               |..|:||||:|:.|.||||.  |:.:  ..||..| :|.|..||  |.::  ||||...::.
 Frog   243 ---GTTGVNSGVMLMNLTRIRNQQFKNNMIPAGLTWEEMLHPLYQKY--KNYITWGDQDLLNIIF 302

  Fly   405 YEYPNLIYRLDCIWNRQLCTWWKDHGYSQIFDAYFRCEGNIKMYHGNC 452
            |..|.::|...|.||     :..||           |     ||..||
 Frog   303 YFNPEMLYVFPCHWN-----YRPDH-----------C-----MYGSNC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 62/279 (22%)
gxylt2XP_002938793.1 GT8_like_2 91..394 CDD:133052 72/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.