DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and b4gat1

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002939368.2 Gene:b4gat1 / 100170600 XenbaseID:XB-GENE-1007367 Length:421 Species:Xenopus tropicalis


Alignment Length:450 Identity:80/450 - (17%)
Similarity:155/450 - (34%) Gaps:155/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARYPDIPATTP 125
            :||.:.:..::.|:.:.:..|:                :||  |..:.|.::|.:.|| :|..| 
 Frog     5 MRCSFFRVALIALLLVALLQLL----------------YLS--LLSNLHGQQQRSAYP-VPVGT- 49

  Fly   126 SVPPVLRPTHYLLNYSSTQLELSSHL-----NGLSSDYNIFVIYTRENYHL---------NLKFD 176
                    :|   ..|.:..||..||     .|:......:.||.    ||         :|...
 Frog    50 --------SH---TGSQSHRELKEHLRAAKVGGILDSSGQYWIYR----HLLPHEKGNWKDLDVV 99

  Fly   177 LFAHS----------LLKHTSAQLHLHVITDSESQPSV----LEILQRQIRRFRRTVIYTIYDVK 227
            |.:|:          |::|...::.|.:...:..|..:    :..|.:.....|:.|.:.:    
 Frog   100 LASHASVNNLGHLQDLVQHWDGRISLALFASNAVQAKLAVMFVYALSQLCPHVRQRVSFHL---- 160

  Fly   228 VCSSI-------IQDIAAKLSPYFSSTPN----------------SYYSDSLFFLSLGLHRIADR 269
            ||.|.       ::|::.     |::.||                :|..::.:..:| |..:|..
 Frog   161 VCKSSDRVTFPELEDLSD-----FATLPNCEAVFSKAADMGIKVVNYAGNASYPNNL-LRNVARA 219

  Fly   270 SLNRA---ILLDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGN 331
            .:..|   :::|.|:|....:|      ..|:.....|:...|..|......|:..|.|.|.   
 Frog   220 GIESAAYVLVVDIDMVPSEGLR------SGFVNLATGGVDQHLVFVVPAFEIRHTRRLPSTK--- 275

  Fly   332 PYYPINNEGGNQHSRVHHGYPGLNSGVVLLLLNRIRNSKSYLEKL-THSEVHTLVAKYSFKGHLG 395
                                      ..|:.|.::...:::.|:| ...:..|   .||...:|.
 Frog   276 --------------------------EELMRLYQVGEVRAFYEELCPRCQAPT---NYSLWINLP 311

  Fly   396 DQDFFTLLGYEY---------PNLIYRLDC-IWNRQLCTWWKDHGYSQIFDAYFRCEGNI 445
            ::.....||..|         |..|.|.|. .::.:    :|.:|:::|..|   ||.|:
 Frog   312 EKKPAAKLGVAYVVEWKDPWEPFYIGRADVPAYDER----FKQYGFNRISQA---CELNM 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 49/300 (16%)
b4gat1XP_002939368.2 Glyco_transf_49 97..414 CDD:404735 55/322 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.