DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Xxylt and large2

DIOPT Version :9

Sequence 1:NP_611871.2 Gene:Xxylt / 37833 FlyBaseID:FBgn0034959 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001096468.1 Gene:large2 / 100125087 XenbaseID:XB-GENE-5871953 Length:723 Species:Xenopus tropicalis


Alignment Length:444 Identity:106/444 - (23%)
Similarity:161/444 - (36%) Gaps:148/444 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LRCRWQKKLVLLLIFICVCVLIVFANTHLLVRGNILSAFLSSRLNKHSHAEKQEARYPDIPATTP 125
            |.||.:.|      |:.:.:|::.|.|.|         :||          ..|..|      .|
 Frog     3 LSCRSKAK------FLALALLLLSAATWL---------YLS----------VGETEY------GP 36

  Fly   126 SVPPVLRPTHYLLNYSSTQLELSSHLN-------------------------GLSSDYNIFVIYT 165
            |:.||  ..|:... .|.||||.|.|.                         |...|.:...   
 Frog    37 SLGPV--APHFSAT-PSLQLELESRLRVAEEENRRLRQQLGEMRNEEQSTGVGTEGDNSSHC--- 95

  Fly   166 RENYHLNLKFDL------------------FAHSLLKHTSAQLHLHVITDSESQPSVLEILQRQI 212
             |:..|..|.:|                  ...|:|.|....||||:|||:.:    |.:|....
 Frog    96 -EHRSLTEKCELIHVAIVCAGHNSSRDVVTLVKSILFHRRNPLHLHLITDAVA----LRVLGNLF 155

  Fly   213 RRFR-RTVIYTIYDVKVCSSIIQDIAAKLSPYFSSTPNSYYSDSLFFLSLGLHRIADRSLNRAIL 276
            :.:. .::..:.|:           |::|.|..:..||.:||.....|.|.|.:.....|::.|:
 Frog   156 KTWMVPSLQISFYN-----------ASELKPDVAWIPNKHYSGIYGLLKLTLTKALPSDLSKVIV 209

  Fly   277 LDCDIVFRSDVRLLFNEFDNFLPHQLYGLAPELTPVYRHILYRYRVRYPKTSFGNPYYPINNEGG 341
            ||.||.|.:|:..|:..|..|...|:.||....:..|...|::....:|  :.|.          
 Frog   210 LDTDITFATDIAELWAIFKKFTGEQVLGLVENQSDWYLGNLWKNHKPWP--ALGR---------- 262

  Fly   342 NQHSRVHHGYPGLNSGVVLLLLNRIRNSKSYLEKLTHSEVHTLVAKYSFKG----HLGDQDFFTL 402
                       |.|:||:||||:::|       .:...|:..|.|:.....    .|.|||.|..
 Frog   263 -----------GFNTGVILLLLDKLR-------LIGWEEMWRLTAERELMNMLSTSLADQDIFNA 309

  Fly   403 LGYEYPNLIYRLDCIWNRQLCTWWKDHG-----YSQIFDAYFRCEGNIKMYHGN 451
            :....|.|:|:|.|.||.||    .||.     ||::.|        :|:.|.|
 Frog   310 VIKSSPTLVYQLPCYWNVQL----SDHTRSEQCYSELAD--------LKVIHWN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XxyltNP_611871.2 Glyco_tranf_GTA_type 172..>422 CDD:299700 67/272 (25%)
large2NP_001096468.1 GT8_LARGE_C 107..386 CDD:133053 75/302 (25%)
Glyco_transf_49 440..709 CDD:290607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8825
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.