DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3907 and Efcab14

DIOPT Version :9

Sequence 1:NP_611870.3 Gene:CG3907 / 37832 FlyBaseID:FBgn0034958 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_038965520.1 Gene:Efcab14 / 298425 RGDID:1310351 Length:523 Species:Rattus norvegicus


Alignment Length:434 Identity:100/434 - (23%)
Similarity:166/434 - (38%) Gaps:117/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKKRRELDALI----------ASQSSSGKRANRRVPGGTNSQDKLLSVSTDDPEDYAWTNVAGSR 71
            ||||:||:|||          ..|.||..|..|..|..::      |.|:.:.|::   ...|:|
  Rat     1 MKKRKELNALIGLAGDSRRKKTKQGSSSHRLLRTEPPDSD------SASSSEEEEF---GAIGNR 56

  Fly    72 RSHRKIAYFR---MCGPL-LFGIMGILIVGI--LYWLYFDLRQQLTDYRQKIEEVSAMSKNFPDT 130
            ....|..|.|   :|.|| .|.|:...:|..  |.|:...|::.|...::|..   .|..|...:
  Rat    57 SRFVKGDYVRCCKICYPLCAFVILAACVVACVGLVWMQMALKEDLDVLKEKFR---TMESNQKSS 118

  Fly   131 LQRWHETSSYLLKNQ-------------TAVISEINDLQKSMESLRNNFSNLEAAVAAQRN---- 178
            .|...:.:..||..:             :.|.:.|.::.|.:..|.:..::|:|.|.:..:    
  Rat   119 FQEIPKLNEELLSKEKQLEKIESGELGLSRVWTNITEMNKQISLLSSAVNHLKANVKSAADLLSL 183

  Fly   179 ----HGKDEKLVADFGAKIEAVATDIEAIKEHYNKYTEVQKTLQAETEALKLNLSQLPTIQANAL 239
                .|. :|.||..|..:.:|:..:|||          |||:......|:|....:.|..:|.:
  Rat   184 PSTVEGL-QKSVASIGNTLNSVSLAVEAI----------QKTVDEHKATLELLQGSVETNGSNQI 237

  Fly   240 ------PANLSDDIAALNKTTFNSFK----LLANDLKNVNNTLSQTTKILSEEISLHKTKIDDLL 294
                  |:.|.      |:|...|.|    .|.|.|:.||:|:          :...:.....|.
  Rat   238 MPSPPPPSELD------NRTHSESAKQDILYLHNSLEEVNSTV----------VGYQRQNDLKLK 286

  Fly   295 DRSENITSHVATISNSWPEYKQKVTSFDESLERIEKEITLANNKNNMLAASVDQLKNFCIQSMGN 359
            ..||       |:||           ..:.|:.||.::        :..:..:|..|.....|||
  Rat   287 GMSE-------TLSN-----------LTQRLDLIESDV--------VALSKAEQRTNVSSSMMGN 325

  Fly   360 IKAPSSEDGSVVPKPEAIAVKQEVIKPSANATVK---LQESLKL 400
            ..|....:.|:..:.:  |||.:.||...|:..:   |:|.|:|
  Rat   326 RAASLKRESSMTNRTD--AVKAQSIKKEDNSNSQVSGLREKLQL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3907NP_611870.3 LXG 147..351 CDD:282581 45/221 (20%)
Efcab14XP_038965520.1 Smc <97..>344 CDD:224117 60/304 (20%)
EFh 427..478 CDD:415501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.