DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3860 and KES1

DIOPT Version :9

Sequence 1:NP_001286802.1 Gene:CG3860 / 37825 FlyBaseID:FBgn0034951 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_015180.1 Gene:KES1 / 855958 SGDID:S000006066 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:457 Identity:108/457 - (23%)
Similarity:164/457 - (35%) Gaps:143/457 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SIWAILKNCIGK---DLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAA------QQEH----- 76
            |.|......|..   |||.::.|..:..|:|..:....:.|:.:|..|.:      .:||     
Yeast     8 SSWTSFLKSIASFNGDLSSLSAPPFILSPISLTEFSQYWAEHPELFLEPSFINDDNYKEHCLIDP 72

  Fly    77 -----PADRMKYVAAFAVSALASNW----ERLG---KPFNPLLGETY--------ELQKGDYRIV 121
                 ...||..|..:.:|.|.|.:    |.||   ||.||.|||.:        ..:.|:..::
Yeast    73 EVESPELARMLAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLL 137

  Fly   122 CEQVSHHPPVSAFHA--ESKDFKFHGTISPKIKFWGKSVEVNPK--GTVTVEFPKWNESYSWTNV 182
            .|||||||||:||..  :....|..|....|..| .||:.:..|  |...::..  :|||..|..
Yeast   138 SEQVSHHPPVTAFSIFNDKNKVKLQGYNQIKASF-TKSLMLTVKQFGHTMLDIK--DESYLVTPP 199

  Fly   183 NCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAG--SGAKNLHRVEGFVKDASETN---- 241
            ...:..|:|...::|..||..|.: :||.:..:.|...|  ||.||..:.. ..||:.::.    
Yeast   200 PLHIEGILVASPFVELEGKSYIQS-STGLLCVIEFSGRGYFSGKKNSFKAR-IYKDSKDSKDKEK 262

  Fly   242 -LYFLYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKMFSKLNSFKLNSFRSLSIQD 305
             ||.:.|:|:...|...|.                        ||..|:|               
Yeast   263 ALYTISGQWSGSSKIIKAN------------------------KKEESRL--------------- 288

  Fly   306 VSSDSYPPMEQEGDIPKSDSAYSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPP 370
                                                        :|.    |.::.|...|:||.
Yeast   289 --------------------------------------------FYD----AARIPAEHLNVKPL 305

  Fly   371 LTLCPTDSRLR-PDIL-HLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNSDDWSPRWFK---YAT 430
            ....|.:||.. .|:. .::.|:.:..:|.||.|||.||..||:.:: ....|..||||   |:.
Yeast   306 EEQHPLESRKAWYDVAGAIKLGDFNLIAKTKTELEETQRELRKEEEA-KGISWQRRWFKDFDYSV 369

  Fly   431 NP 432
            .|
Yeast   370 TP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3860NP_001286802.1 Oxysterol_BP 26..441 CDD:279564 108/457 (24%)
KES1NP_015180.1 Oxysterol_BP 12..363 CDD:395990 102/443 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.