DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3860 and Osbp

DIOPT Version :9

Sequence 1:NP_001286802.1 Gene:CG3860 / 37825 FlyBaseID:FBgn0034951 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_477271.1 Gene:Osbp / 42985 FlyBaseID:FBgn0020626 Length:784 Species:Drosophila melanogaster


Alignment Length:492 Identity:165/492 - (33%)
Similarity:236/492 - (47%) Gaps:117/492 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGDYAEHVERTELPA--------------TMISRKE----------VSIWAILKNCIGKDLSKIT 43
            :||..:.|::. |||              .:|.::.          :|:|.|:|||||||||||.
  Fly   353 QGDDDDDVDKA-LPAKESTDSIYGRNWNPDLIKKRRDRVPDKPNHPISLWGIMKNCIGKDLSKIP 416

  Fly    44 MPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLG 108
            ||:..|||||.||||.|..||.::|..||..:...:::.|:|||.|||.|:...|.|||||||||
  Fly   417 MPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLG 481

  Fly   109 ETYELQKGD---YRIVCEQVSHHPPVSAFHAESKDFKFHGTISPKIKFWGKSVEVNPKGTVTVEF 170
            ||||..:.|   :|.:.|||||||||:|.|.|||::......|...||.||.|::||.|.|.|:|
  Fly   482 ETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKFRGKYVQINPLGGVYVQF 546

  Fly   171 PKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEI--TNHATGHVASLTFKSAGSGAKNLHR-VEG 232
            |.....|||..|...|:|||||:||::|:|:|||  :..|.||...|.|......::::.| |:|
  Fly   547 PNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFSRDVQRSVKG 611

  Fly   233 FVKDASETNLYFLYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKMFSKLNSFKLNS 297
            .|.:......:.:.|.|                                                
  Fly   612 VVMNKDNEVKWVVRGTW------------------------------------------------ 628

  Fly   298 FRSLSIQDVSSDSYPPMEQEGDIPKSDSAYSLDIPDSTT-----LWSCKPRPSNCSEYYQFTHFA 357
                   |:..:..|.::..|         |:..|..||     .|..:|.|.:..::|.||..|
  Fly   629 -------DMKIEIAPVLKTSG---------SVSSPTYTTGEFKLAWRRRPAPPDSDKFYNFTTLA 677

  Fly   358 LQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNSDD-- 420
            .|||..:..      :.|||||||||...:|:|:.|.::|||.||||||| |.::|:...:::  
  Fly   678 CQLNEEEEG------VAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQR-TERRRRENEAEEAA 735

  Fly   421 --------WSPRWFKYATNPHTKIDDWLYSGGYWDRK 449
                    :.|.|||......::....::...||:.|
  Fly   736 AEGRPYPAYEPMWFKREKEEGSEEYVHVFKNTYWEAK 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3860NP_001286802.1 Oxysterol_BP 26..441 CDD:279564 155/435 (36%)
OsbpNP_477271.1 PH 15..107 CDD:278594
PH_OSBP_ORP4 17..113 CDD:270101
Oxysterol_BP 399..764 CDD:279564 155/435 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460435
Domainoid 1 1.000 260 1.000 Domainoid score I482
eggNOG 1 0.900 - - E1_KOG1737
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100030at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10972
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3013
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.