DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3860 and CG42668

DIOPT Version :9

Sequence 1:NP_001286802.1 Gene:CG3860 / 37825 FlyBaseID:FBgn0034951 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001189250.2 Gene:CG42668 / 42412 FlyBaseID:FBgn0261550 Length:990 Species:Drosophila melanogaster


Alignment Length:477 Identity:122/477 - (25%)
Similarity:189/477 - (39%) Gaps:136/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGDYAEHVERTELPATMISRKEVSIWAILKNC-IGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQ 66
            |.::.|..|:.|   .:....:..||.|:|.. .|.||||:.:|..:.||.|||.:|.:...:|.
  Fly   450 EEEFGEQGEQVE---ELAEENKSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHAD 511

  Fly    67 LLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYEL-------QKGDYRIVCEQ 124
            ||::|.|::....|||.|..:.:|:.....:.|.||:||:|||.:..       .:..|  :.||
  Fly   512 LLSKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFY--IAEQ 574

  Fly   125 VSHHPPVSAFHAESKD--FKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVH 187
            ||||||||||:..:::  |....:|..|.||:|.|.....:|..|:......|.|:.|.......
  Fly   575 VSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATTPYAHCK 639

  Fly   188 NIIVGRLWIEQYGKMEITNHATGHVASLTFK----SAGSGAKNLHRVEGFVKDASETNLYFLYGK 248
            .|::|.|.:|..||:.|....||:...|.||    ..|:.|.|:  |.|.:|...|| |..:.|.
  Fly   640 GILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADATNV--VVGKIKLGKET-LATINGH 701

  Fly   249 WTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKMF---SKLNSFKLNSFR-SLSIQDVSSD 309
            |.:  :|              |..|    |..|....:|   ::..|.:|..:. .|.:|:.:  
  Fly   702 WDK--EC--------------RVKD----SKTGEETVLFKVDAETRSKRLTRYMVPLDLQEAN-- 744

  Fly   310 SYPPMEQEGDIPKSDSAYSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLC 374
                                   :|..||                                    
  Fly   745 -----------------------ESQRLW------------------------------------ 750

  Fly   375 PTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNS---------DDWSPRWFKYA- 429
               .|:...|.:.::   ..|::|||.|||:||...|:|.|::|         |.:....:||| 
  Fly   751 ---QRVSEAIANEDQ---VAATEEKTVLEERQRADAKERLSSDSVHMPDLFELDSYGQWLYKYAD 809

  Fly   430 TNPHTKIDDWLYSGGYWDRKYD 451
            ..|             ||.:.|
  Fly   810 LRP-------------WDSRND 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3860NP_001286802.1 Oxysterol_BP 26..441 CDD:279564 115/442 (26%)
CG42668NP_001189250.2 PH_OPR5_ORP8 231..361 CDD:270103
PH 238..356 CDD:278594
Oxysterol_BP 471..796 CDD:279564 110/416 (26%)
Prefoldin <849..943 CDD:238453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.