DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3860 and CG1513

DIOPT Version :9

Sequence 1:NP_001286802.1 Gene:CG3860 / 37825 FlyBaseID:FBgn0034951 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_610534.3 Gene:CG1513 / 36028 FlyBaseID:FBgn0033463 Length:784 Species:Drosophila melanogaster


Alignment Length:476 Identity:107/476 - (22%)
Similarity:179/476 - (37%) Gaps:126/476 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DY-AEHVERTELPATMISRKEVSIWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLL 68
            || |.:.|..|...:|.:...:....:.:..||.||:|:.:|..:.|..|.|:...:|..:..|.
  Fly   397 DYDALYEEEEETDLSMEAHGSMITHLLSQVKIGMDLTKVVLPTFILERRSLLEMYADYFAHPDLF 461

  Fly    69 TEAAQQEHPADRMKYVAAFAVSALASNWER--LGKPFNPLLGETYE------------------- 112
            .:.:..:.|.||:..|..:.:||..:..:.  ..||:||:|||.::                   
  Fly   462 IKISDLDDPRDRIVQVCRWYMSAYHAGRKSAVAKKPYNPILGEVFQCHWDIPGISQDAQEVRDGP 526

  Fly   113 ---LQKGDYRIVCEQVSHHPPVSAFHAE--SKDFKFHGTISPKIKFWGKSVEVNPKGTVTVEFPK 172
               .::.....:.||||||||:|||:||  :|...|...:..|.||.|.|:.|:..|...|....
  Fly   527 VPWCRRDQLTFLAEQVSHHPPISAFYAEHYNKKITFAAHVWTKSKFLGLSIGVHNIGEGVVTLVD 591

  Fly   173 WNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTF--KSAGSGAKNLHRVEGFVK 235
            .:|.|..|..|....:|:... |||..|.:||....:|:.|::.|  |....|.:|  ||...|.
  Fly   592 RSEEYIVTFPNGYGRSILTVP-WIELGGSVEIKCPQSGYYANVEFLTKPFYGGKRN--RVSAEVY 653

  Fly   236 DASETNLYF-LYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKMFSKLNSFKLNSFR 299
            ..||...:. :.|:|:                 |..:...:|  .|.|  ::|..:|  ::..|:
  Fly   654 APSEKKPFVSITGEWS-----------------GLMEAKWHD--KNKT--EVFVDVN--RIPIFK 695

  Fly   300 SLSIQDVSSDSYPPMEQEGDIPKSDSAYSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMD 364
            ......|..|.|                     :|..:|.                   ::.|  
  Fly   696 KQVRPIVEQDEY---------------------ESRRVWK-------------------EVTA-- 718

  Fly   365 SNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNSDDWSPRWFKYA 429
                                 .|:..:::.|:..|..:|::||...|.||..:. .|..:.||..
  Fly   719 ---------------------GLKFNDIERATTAKFVVEQQQRDQAKVRKEYDL-AWEHKHFKPV 761

  Fly   430 TNPHTKIDDWLYSGGYWDRKY 450
            .      |:|:|:.....|.|
  Fly   762 G------DNWIYAKPLSQRMY 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3860NP_001286802.1 Oxysterol_BP 26..441 CDD:279564 98/443 (22%)
CG1513NP_610534.3 PH_ORP9 24..125 CDD:241444
PH 25..118 CDD:278594
Oxysterol_BP 421..767 CDD:279564 98/441 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.