DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and CPK27

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_192379.2 Gene:CPK27 / 825805 AraportID:AT4G04700 Length:485 Species:Arabidopsis thaliana


Alignment Length:283 Identity:91/283 - (32%)
Similarity:145/283 - (51%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 LGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKE-VPIEIHL 632
            |.|.:|.|....::|||.:|........|.......|.|||.||      |..:|:| |..||.:
plant    21 LVDITKIYILGEELGRGNFGLTRKCVEKSTGKTFACKTILKTKL------KDEECEEDVKREIRI 79

  Fly   633 LQTLN-HKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMD------EKLGSYIFRQVA 690
            ::.|: ..|||...:.:|:.....:|||..|.| :|:..|  ..|.|      ||..:.|.|.:.
plant    80 MKQLSGEPNIVEFKNAYEDKDSVHIVMEYCGGG-ELYDKI--LALYDVGKSYSEKEAAGIIRSIV 141

  Fly   691 DAVNYLHEQKILHRDIKDENIII---DQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLA 752
            :.|...|...::|||:|.||.::   |.|.|:|:||||.:.|:||||.:....|:..|.:||||.
plant   142 NVVKNCHYMGVMHRDLKPENFLLTSNDDNATVKVIDFGCSVFIEEGKVYQDLAGSDYYIAPEVLQ 206

  Fly   753 GNRYVGPELEIWALGVTLYVLMFFENPFI-DVEETLKAEIQ-IPKAVSEQ--------LSRLLSS 807
            ||  .|.|.:||:.|:.||:|:..::||: :.|..:..||: :....||:        ...|:..
plant   207 GN--YGKEADIWSAGIILYILLCGKSPFVKEPEGQMFNEIKSLEIDYSEEPWPLRDSRAIHLVKR 269

  Fly   808 MLNKDPKYRCTMHQLITDPWLTQ 830
            ||:::||.|.:..:::..||:.:
plant   270 MLDRNPKERISAAEVLGHPWMKE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 87/273 (32%)
S_TKc 576..828 CDD:214567 87/272 (32%)
CPK27NP_192379.2 S_TKc 28..290 CDD:214567 87/272 (32%)
STKc_CAMK 28..289 CDD:270687 86/271 (32%)
PTZ00184 325..468 CDD:185504
EFh 337..396 CDD:238008
EFh 411..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.