DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and pim3

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_001030150.2 Gene:pim3 / 565041 ZFINID:ZDB-GENE-050809-111 Length:320 Species:Danio rerio


Alignment Length:320 Identity:93/320 - (29%)
Similarity:152/320 - (47%) Gaps:28/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 LTSTFNSMA----STVEQSLGQVIKTTAAQNSSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGR 584
            |.|.|.|.:    :|....|...|:..||:....|                 :.|.|.....:|.
Zfish     2 LLSKFGSFSHICNTTNIDHLPVKIQLQAAKTEREP-----------------FEKVYHVGSVLGS 49

  Fly   585 GAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTL--NHKNIVSVLDV 647
            |.:|.|....|.||.|.|..|.:.||::.....:..   ..:|:||.||:.:  ..:.::.::|.
Zfish    50 GGFGTVYAGTRISDALPVAIKHVAKERVTEWGTING---SLIPLEIVLLKKVGSTFQGVIKLIDW 111

  Fly   648 FENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENII 712
            :|....:.::||:.....||:.:|..:..:||......||||.:||.:.:...::||||||||::
Zfish   112 YERPDGWLIIMERPEMVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLL 176

  Fly   713 ID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFF 776
            :| :...:|||||||...::: ..::.|.||..|..||.:..:||.|....:|:|||.||.::..
Zfish   177 VDLRTGDLKLIDFGSGAILKD-TVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCG 240

  Fly   777 ENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPST 836
            :.||...||.|:..:...:.||....:|:...|...|..|.|:.|:....|:..|.||.|
Zfish   241 DIPFEHDEEILRGRLFFRRRVSPVCQQLIKWCLCLRPSDRPTLEQIFEHQWMRTEENPKT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 77/255 (30%)
S_TKc 576..828 CDD:214567 77/254 (30%)
pim3NP_001030150.2 STKc_PIM3 40..292 CDD:271004 77/255 (30%)
Pkinase 41..292 CDD:278497 77/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.