| Sequence 1: | NP_611864.1 | Gene: | Pask / 37824 | FlyBaseID: | FBgn0034950 | Length: | 985 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_996790.3 | Gene: | PRKAA1 / 5562 | HGNCID: | 9376 | Length: | 574 | Species: | Homo sapiens |
| Alignment Length: | 37 | Identity: | 8/37 - (21%) |
|---|---|---|---|
| Similarity: | 16/37 - (43%) | Gaps: | 0/37 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 SQLVEKLKFGEKYILANIVVLPLDKAPARVALKSDAT 40 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pask | NP_611864.1 | PAS | 70..171 | CDD:473914 | |
| PAS | 182..350 | CDD:441804 | |||
| PAS | 286..>325 | CDD:238075 | |||
| STKc_PASK | 575..828 | CDD:270906 | |||
| PRKAA1 | NP_996790.3 | STKc_AMPK_alpha | 24..294 | CDD:270981 | 8/37 (22%) |
| UBA_AID_AAPK1 | 311..375 | CDD:270586 | |||
| AMPKA1_C | 419..572 | CDD:213384 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||