DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and PRKAA1

DIOPT Version :10

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_996790.3 Gene:PRKAA1 / 5562 HGNCID:9376 Length:574 Species:Homo sapiens


Alignment Length:37 Identity:8/37 - (21%)
Similarity:16/37 - (43%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQLVEKLKFGEKYILANIVVLPLDKAPARVALKSDAT 40
            :|.:|.:|.|:..:............|..:.:|:|.|
Human   196 TQYLENMKIGDTILFRGPTGRLFYNEPGTLLIKTDKT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS 70..171 CDD:473914
PAS 182..350 CDD:441804
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906
PRKAA1NP_996790.3 STKc_AMPK_alpha 24..294 CDD:270981 8/37 (22%)
UBA_AID_AAPK1 311..375 CDD:270586
AMPKA1_C 419..572 CDD:213384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.