DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and Pim3

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_663453.1 Gene:Pim3 / 223775 MGIID:1355297 Length:326 Species:Mus musculus


Alignment Length:262 Identity:85/262 - (32%)
Similarity:138/262 - (52%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 YSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTL 636
            :.|.|.....:|.|.:|.|....|.:|.|.|..|.::||::...   .|.....||:|:.||:.:
Mouse    36 FEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEW---GSLGGVAVPLEVVLLRKV 97

  Fly   637 ----NHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLH 697
                ..:.::.:||.||....:.||:|:.....||:.||..|..:||.|....|.||..||.:.|
Mouse    98 GAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCH 162

  Fly   698 EQKILHRDIKDENIIID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPEL 761
            ...::||||||||:::| ::..:|||||||...::: ..::.|.||..|..||.:..:||.|...
Mouse   163 NCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKD-TVYTDFDGTRVYSPPEWIRYHRYHGRSA 226

  Fly   762 EIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDP 826
            .:|:|||.||.::..:.||...||.|:..:...:.||.:..:|:...|:..|..|.::.|:...|
Mouse   227 TVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHP 291

  Fly   827 WL 828
            |:
Mouse   292 WM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 83/257 (32%)
S_TKc 576..828 CDD:214567 83/256 (32%)
Pim3NP_663453.1 PKc_like 39..293 CDD:354810 83/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.