DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pask and PIM2

DIOPT Version :9

Sequence 1:NP_611864.1 Gene:Pask / 37824 FlyBaseID:FBgn0034950 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_006866.2 Gene:PIM2 / 11040 HGNCID:8987 Length:311 Species:Homo sapiens


Alignment Length:283 Identity:87/283 - (30%)
Similarity:143/283 - (50%) Gaps:22/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 YEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVP 627
            :|.|..||..         :|:|.:|.|....|.:|||.|..|.|.:.::.....:.  |....|
Human    28 FEAEYRLGPL---------LGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLS--DSVTCP 81

  Fly   628 IEIHLLQTL----NHKNIVSVLDVFENDLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQ 688
            :|:.||..:    .|..::.:||.||....:.||:|:.....||:.:|..:..:.|......|.|
Human    82 LEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQ 146

  Fly   689 VADAVNYLHEQKILHRDIKDENIIID-QNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLA 752
            |..|:.:.|.:.::|||||||||:|| :....|||||||...:.: :.::.|.||..|..||.::
Human   147 VVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHD-EPYTDFDGTRVYSPPEWIS 210

  Fly   753 GNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRC 817
            .::|......:|:||:.||.::..:.||...:|.|:||:..|..||.....|:...|...|..|.
Human   211 RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRP 275

  Fly   818 TMHQLITDPWL---TQEV--NPS 835
            ::.:::.|||:   .::|  |||
Human   276 SLEEILLDPWMQTPAEDVPLNPS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaskNP_611864.1 PAS_9 74..169 CDD:290162
PAS 74..169 CDD:238075
PAS_9 286..>335 CDD:290162
PAS 286..>325 CDD:238075
STKc_PASK 575..828 CDD:270906 78/257 (30%)
S_TKc 576..828 CDD:214567 78/256 (30%)
PIM2NP_006866.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
STKc_PIM2 31..287 CDD:271003 82/267 (31%)
S_TKc 32..286 CDD:214567 80/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.