DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phm and NHLRC3

DIOPT Version :9

Sequence 1:	NP_477225.1	Gene:	Phm / 37823	FlyBaseID:	FBgn0283509	Length:	365	Species:	Drosophila melanogaster
Sequence 2:	NP_001012772.1	Gene:	NHLRC3 / 387921	HGNCID:	33751	Length:	347	Species:	Homo sapiens

Alignment Length:	79	Identity:	18/79 - (22%)
Similarity:	29/79 - (36%)	Gaps:	12/79 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   290 GDKIAVRCTMQSTRHRTTKIGPTNEDEMCNFYL-----MYYVDHGETLNMKFCFSQGAPYYFWSN 349
            ||.:.|   :.:...:.|.:.|...|.....|:     :|.||....||.:...........|.:
Human   142 GDLVQV---LGTPGKKGTSLNPLQFDNPAELYVEDTGDIYIVDGDGGLNNRLIKLSQDFMILWLH 203

  Fly   350 PDSGL----HNIPH 359
            .::|.    .||||
Human   204 GENGTGPAKFNIPH 217

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phm	NP_477225.1	Cu2_monooxygen	51..179	CDD:279429
Phm	NP_477225.1	Cu2_monoox_C	201..350	CDD:281675	13/64 (20%)
NHLRC3	NP_001012772.1	NHL 1	47..93
		NHL	66..336	CDD:302697	18/79 (23%)
		NHL repeat	107..153	CDD:271320	3/13 (23%)
		NHL 2	150..196		9/45 (20%)
		NHL repeat	166..205	CDD:271320	7/38 (18%)
		NHL 3	200..243		6/18 (33%)
		NHL repeat	213..250	CDD:271320	4/5 (80%)
		NHL repeat	258..295	CDD:271320
		NHL 4	294..338
		NHL repeat	308..335	CDD:271320
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2722
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030