DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phm and Pam

DIOPT Version :9

Sequence 1:NP_477225.1 Gene:Phm / 37823 FlyBaseID:FBgn0283509 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_017451775.1 Gene:Pam / 25508 RGDID:3252 Length:977 Species:Rattus norvegicus


Alignment Length:364 Identity:130/364 - (35%)
Similarity:186/364 - (51%) Gaps:38/364 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLIGVISVDGLVKEGDYQNSLYQQNLE-----SNSATGATA----------SFPFLMPNVSPQ 62
            ||||:|::::...........|::::..|     ||...|...          :....||.|:|:
  Rat    10 LLLLLGLLALQSSCLAFRSPLSVFKRFKETTRSFSNECLGTIGPVTPLDASDFALDIRMPGVTPK 74

  Fly    63 TPDLYLCTPIKVDPTTTYYIVGFNPNATMNTAHHMLLYGCGEPGTSKTTWNCGEMNRASQEESAS 127
            ..|.|.|..:::......:::.|.|.|:|:|.|||||:||..|.::.:.|.|.|          .
  Rat    75 ESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDE----------G 129

  Fly   128 PCGPHSNSQIVYAWARDAQKLNLPEGVGFKVGKNSPIKYLVLQVHYAHIDKFKDGSTDDSGVFLD 192
            .|...:|  |:|||||:|....||:||||:||..:..||.||||||..|..|:|...|.|||.:.
  Rat   130 TCTDKAN--ILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVH 192

  Fly   193 YTEEPRKKLAGT-LLLGTDGQI-PAMKTEHLETACEVNEQKVLHPFAYRVHTHGLGKVVSGYRVR 255
            .|..|:..:||. |::..|..| |..|..:.:.:|:. :...:|.||||||||.|||||||||||
  Rat   193 LTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQY-KMYPMHVFAYRVHTHHLGKVVSGYRVR 256

  Fly   256 TNSDGEQEWLQLGKRDPLTPQMFYNTSNTDPIIEGDKIAVRCTMQST-RHRTTKIGPTNEDEMCN 319
            ..     :|..:|:::|..||.||...:...:..||.:|.||..... |...|.||.|:.|||||
  Rat   257 NG-----QWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCN 316

  Fly   320 FYLMYYVDHGETLNMKFCFSQGAPYYFWSNPDSGLHNIP 358
            .|:|||::....|:...|....||..|.:.|...  |||
  Rat   317 LYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEA--NIP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhmNP_477225.1 Cu2_monooxygen 51..179 CDD:279429 49/127 (39%)
Cu2_monoox_C 201..350 CDD:281675 59/151 (39%)
PamXP_017451775.1 Cu2_monooxygen 64..173 CDD:395859 46/120 (38%)
Cu2_monoox_C 201..347 CDD:397669 59/151 (39%)
NHL_PAL_like 503..810 CDD:271328
NHL repeat 517..578 CDD:271328
NHL repeat 584..625 CDD:271328
NHL repeat 636..674 CDD:271328
NHL repeat 686..724 CDD:271328
NHL repeat 732..777 CDD:271328
NHL repeat 783..809 CDD:271328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6726
eggNOG 1 0.900 - - E1_KOG3567
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.