powered by:
Protein Alignment Phm and pgal-1
DIOPT Version :9
Sequence 1: | NP_477225.1 |
Gene: | Phm / 37823 |
FlyBaseID: | FBgn0283509 |
Length: | 365 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491475.2 |
Gene: | pgal-1 / 172108 |
WormBaseID: | WBGene00017671 |
Length: | 350 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
Similarity: | 21/42 - (50%) |
Gaps: | 9/42 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 323 MYYVDHGETLNMKFCFSQGAPYYFWSNPDSGLHNIPHIEAST 364
::|:.||.|:: :.|. :|.. |.|.|.:..|:|.|
Worm 123 LFYMPHGLTID-----NNGD---YWVT-DVGSHQVHKIDAKT 155
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3567 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002923 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2722 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.930 |
|
Return to query results.
Submit another query.