DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phm and pgal-1

DIOPT Version :10

Sequence 1:NP_477225.1 Gene:Phm / 37823 FlyBaseID:FBgn0283509 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_491475.2 Gene:pgal-1 / 172108 WormBaseID:WBGene00017671 Length:350 Species:Caenorhabditis elegans


Alignment Length:42 Identity:12/42 - (28%)
Similarity:21/42 - (50%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 MYYVDHGETLNMKFCFSQGAPYYFWSNPDSGLHNIPHIEAST 364
            ::|:.||.|::     :.|.   :|.. |.|.|.:..|:|.|
 Worm   123 LFYMPHGLTID-----NNGD---YWVT-DVGSHQVHKIDAKT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhmNP_477225.1 Cu2_monooxygen 52..180 CDD:460053
Cu2_monoox_C 200..350 CDD:461021 6/26 (23%)
pgal-1NP_491475.2 NHL_PAL_like 59..344 CDD:271328 12/42 (29%)
NHL repeat 62..121 CDD:271328
NHL repeat 127..167 CDD:271328 11/38 (29%)
NHL repeat 178..215 CDD:271328
NHL repeat 225..265 CDD:271328
NHL repeat 321..344 CDD:271328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.