DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phm and pgal-1

DIOPT Version :9

Sequence 1:NP_477225.1 Gene:Phm / 37823 FlyBaseID:FBgn0283509 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_491475.2 Gene:pgal-1 / 172108 WormBaseID:WBGene00017671 Length:350 Species:Caenorhabditis elegans


Alignment Length:42 Identity:12/42 - (28%)
Similarity:21/42 - (50%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 MYYVDHGETLNMKFCFSQGAPYYFWSNPDSGLHNIPHIEAST 364
            ::|:.||.|::     :.|.   :|.. |.|.|.:..|:|.|
 Worm   123 LFYMPHGLTID-----NNGD---YWVT-DVGSHQVHKIDAKT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhmNP_477225.1 Cu2_monooxygen 51..179 CDD:279429
Cu2_monoox_C 201..350 CDD:281675 6/26 (23%)
pgal-1NP_491475.2 NHL_PAL_like 59..344 CDD:271328 12/42 (29%)
NHL repeat 62..121 CDD:271328
NHL repeat 127..167 CDD:271328 11/38 (29%)
NHL repeat 178..215 CDD:271328
NHL repeat 225..265 CDD:271328
NHL repeat 321..344 CDD:271328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3567
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2722
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.