DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX13

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_005677.2 Gene:SOX13 / 9580 HGNCID:11192 Length:622 Species:Homo sapiens


Alignment Length:394 Identity:106/394 - (26%)
Similarity:165/394 - (41%) Gaps:117/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQATTEPPLSL--RPGTVPT-VPATTPARPATITIQRRHPAPKADSTPHTLPPFSPSPSPASSP 66
            |.|....||..:  |||.:.| .|...|::|..:|.:     |||...|:|          :|||
Human   262 PLQLLHSPPAPVVKRPGAMATHHPLQEPSQPLNLTAK-----PKAPELPNT----------SSSP 311

  Fly    67 SPAPAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTP-----------KTPEPRSTHTHTHT 120
            |           .:..:.:..|.:...|:..:.::.|..|           |..:......|:|:
Human   312 S-----------LKMSSCVPRPPSHGGPTRDLQSSPPSLPLGFLGEGDAVTKAIQDARQLLHSHS 365

  Fly   121 HSQHFSP--PPRESEMDGERSPS---------HSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYS 174
            .:...||  |.|:..:..:.||:         |...|..||.| :|.|..|..:|   |||    
Human   366 GALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCD-MDGSRHFPESR---NSS---- 422

  Fly   175 DATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIE 239
                       ||||||||||||::.|||||.:..||:||:.|||.||.||:.::..:||||..|
Human   423 -----------HIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEE 476

  Fly   240 AEKLRKLHMIEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGR 304
            ..:|.:.|:.:||:|||:|:.|:|              |                .:.|      
Human   477 QARLSRQHLEKYPDYKYKPRPKRT--------------C----------------IVEG------ 505

  Fly   305 KSKRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKMESAE-QLNSADIILPSADNLISYQS--SEY 366
              ||    .:.|.....:|....|  ::..|.:..::.: |::|:|::.|.|..:...|.  ..|
Human   506 --KR----LRVGEYKALMRTRRQD--ARQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHY 562

  Fly   367 LPLS 370
            :|.|
Human   563 VPRS 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 39/70 (56%)
SOX13NP_005677.2 SOX-TCF_HMG-box 423..494 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.