DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and HMGB1

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:127 Identity:30/127 - (23%)
Similarity:52/127 - (40%) Gaps:4/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GSARVPVNSSTPYSDATRTK-KHSPGHIKRPMNAFMVWSQMERRKICERTPDLHN-AEISKELGR 223
            |..:.|....|........| |..|...||..:||.|:.:..|....:..|::.. :.:.|..|:
plant    26 GKRKAPAEKPTKRETRKEKKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQ 90

  Fly   224 RWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTT 285
            :|:.:|:.:|.||..:|.|.:..:..:...|....::....|..|.....|.|  ||..:.|
plant    91 KWKSMSQAEKAPYEEKAAKRKAEYEKQMDAYNKNLEEGSDESEKSRSEINDED--EASGEVT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 17/75 (23%)
HMGB1NP_974413.1 PRK05901 1..>171 CDD:235640 30/127 (24%)
HMG-box_AtHMGB1-like 54..114 CDD:438821 16/59 (27%)

Return to query results.
Submit another query.