DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox12

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:177 Identity:74/177 - (41%)
Similarity:94/177 - (53%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQL 227
            ||.|....||           .|||||||||||||||.|||||.::.||:|||||||.|||||||
  Rat    27 AREPGWCKTP-----------SGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQL 80

  Fly   228 LSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLT 292
            |...:|.|::.|||:||..||.:||:|||||:||...:|...:|.....|        ...:.|.
  Rat    81 LQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGG--------GGGSRLK 137

  Fly   293 TLAINGTTTAGRKSKRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKM 339
            .    |....||..:|:|.....|.|:  ...|..:...:...||::
  Rat   138 P----GPQLPGRGGRRATGGPLGGGAA--APEDDDEDEEEELLEVRL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 49/70 (70%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 49/70 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342386
Domainoid 1 1.000 106 1.000 Domainoid score I6444
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm44720
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.