DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Pdlim7

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001107560.1 Gene:Pdlim7 / 67399 MGIID:1914649 Length:457 Species:Mus musculus


Alignment Length:183 Identity:40/183 - (21%)
Similarity:54/183 - (29%) Gaps:67/183 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPNQATTEPPLSLRPGTVPTVPATTPAR------PATITIQR-----RHPAPKADSTPHTL--- 53
            :||.:|.|.|....|....|:......||      |...|:::     |.|.|  |::...|   
Mouse    89 SKPQKALTPPADPPRYTFAPSASLNKTARPFGAPPPTDSTLRQNGQLLRQPVP--DASKQRLMED 151

  Fly    54 -PPFSPSPSPASSPS--------------------------------PAPAQT------PGAQKT 79
             ..:.|.|....|.|                                ||||.|      ||    
Mouse   152 TEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEFMKKSSQVPRTEAPAPASTIPQESWPG---- 212

  Fly    80 QSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRES 132
                    |...:..|.|..|..|...:...|..|.|....|||..:|.|.::
Mouse   213 --------PTTPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
Pdlim7NP_001107560.1 PDZ_signaling 5..79 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..166 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..226 10/52 (19%)
LIM1_Enigma 282..333 CDD:188836
LIM2_Enigma 341..392 CDD:188840
LIM3_Enigma 400..454 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.