DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SRY

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_003131.1 Gene:SRY / 6736 HGNCID:11311 Length:204 Species:Homo sapiens


Alignment Length:171 Identity:59/171 - (34%)
Similarity:89/171 - (52%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FGSARVPVNSSTPYSDATR-------------------------TKKHSPGH----IKRPMNAFM 195
            :.||.:.|.:|..||.|.:                         |.::|.|:    :|||||||:
Human     4 YASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFI 68

  Fly   196 VWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQK 260
            |||:.:|||:....|.:.|:||||:||.:|::|::.:|.|:..||:||:.:|..:||||||||::
Human    69 VWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRR 133

  Fly   261 KQTRSPG--SLKPNQDA---------DGCEARNDTTNNNNS 290
            |....|.  ||.|...|         |....|:|.|...:|
Human   134 KAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 35/74 (47%)
SRYNP_003131.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000269|PubMed:15297880 59..136 39/76 (51%)
SOX-TCF_HMG-box 59..130 CDD:238684 35/70 (50%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:12764225, ECO:0000269|PubMed:15746192 61..77 11/15 (73%)
Sufficient for interaction with EP300. /evidence=ECO:0000269|PubMed:15297880 107..139 15/31 (48%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:15297880 130..136 3/5 (60%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 138..155 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..204 59/171 (35%)
Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269|PubMed:9054412 198..204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.