DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX12

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_008874.2 Gene:SOX12 / 6666 HGNCID:11198 Length:315 Species:Homo sapiens


Alignment Length:273 Identity:86/273 - (31%)
Similarity:121/273 - (44%) Gaps:77/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPM 191
            |||..       .|:..|                  ||.|....||           .|||||||
Human    16 PPPGP-------GPAEEG------------------AREPGWCKTP-----------SGHIKRPM 44

  Fly   192 NAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKY 256
            ||||||||.|||||.::.||:|||||||.||||||||...:|.|::.|||:||..||.:||:|||
Human    45 NAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKY 109

  Fly   257 RPQKK--------QTRSPGS------LKPNQDADGCEAR---------------NDTTNNNNSLT 292
            ||:||        :.|.||.      |||.....|...|               :|..:::..|.
Human   110 RPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELL 174

  Fly   293 TLAINGT--------TTAGR----KSKRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKMESAEQL 345
            .:.:..|        ..|||    :::|:......|:|:....:.:.....:|:.|.:..:|.:.
Human   175 EVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEE 239

  Fly   346 NSADIILPSADNL 358
            ...:.:....::|
Human   240 GEEETVASGEESL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 49/70 (70%)
SOX12NP_008874.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 11/59 (19%)
SOX-TCF_HMG-box 39..110 CDD:238684 49/70 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..288 32/153 (21%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q04890 283..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148485
Domainoid 1 1.000 109 1.000 Domainoid score I6341
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm40581
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.